PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.CST5R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 534aa    MW: 57720.8 Da    PI: 7.4298
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.CST5RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.37.6e-34243300260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK+vkgsefprsYY+Ct+ +Cpvkkkver+  d++++ei+Y+g+Hnhek
  Aradu.CST5R 243 DDGYNWRKYGQKQVKGSEFPRSYYKCTHLNCPVKKKVERAP-DGHITEIIYKGQHNHEK 300
                  8****************************************.***************85 PP

2WRKY107.28.4e-34420478159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++dpk+v++tYeg+Hnh+
  Aradu.CST5R 420 LDDGYRWRKYGQKVVKGNPHPRSYYKCTSAGCNVRKHVERASSDPKAVITTYEGKHNHD 478
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-30230302IPR003657WRKY domain
SuperFamilySSF1182902.35E-26240301IPR003657WRKY domain
SMARTSM007741.3E-37242300IPR003657WRKY domain
PROSITE profilePS5081123.571243301IPR003657WRKY domain
PfamPF031065.1E-26243299IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-37405480IPR003657WRKY domain
SuperFamilySSF1182901.03E-29412480IPR003657WRKY domain
PROSITE profilePS5081139.226415480IPR003657WRKY domain
SMARTSM007744.8E-40420479IPR003657WRKY domain
PfamPF031061.7E-26421478IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MSTTDANSAA APPQSSRPTI TLPPRPSAEA FFSGAGAGIS PGPMTLVSSF FSDGGGSDSD  60
YRSFSQLLAG AMASPLAFGG ASRPPFPPPE NPGENSGEEG AQKSLGFKQS RPMNLVVARS  120
PMFTIPPGLS PSGFLNSPGF FSPQSPFGMS HQQALAQVTA QAVFAQSQMH MQADYQAPAV  180
TAPTAPANPS VEQPSFTQNE ASQQQVVPSV SEPSNAQVET SDISNTDNKK FQPSSMVIDK  240
PADDGYNWRK YGQKQVKGSE FPRSYYKCTH LNCPVKKKVE RAPDGHITEI IYKGQHNHEK  300
PQANRRVKEN NDSNGNSNVP PKSELNSQGW VGNATKVAES IPDCSVPESD QTSNQGASRL  360
PGSSESEEVG NVDNREEGDD GEPNPKRRNT DVAVSEVPLS QKTVTEPKII VQTRSEVDLL  420
DDGYRWRKYG QKVVKGNPHP RSYYKCTSAG CNVRKHVERA SSDPKAVITT YEGKHNHDVP  480
AARSSSHNTA SNNSVPLKPH NPVPQKHPLL KDMDFGSNDQ RPVHLRLKEE QIIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-40243481878Probable WRKY transcription factor 4
2lex_A3e-40243481878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015962734.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-154WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A0S3RRX90.0A0A0S3RRX9_PHAAN; Uncharacterized protein
STRINGGLYMA18G49830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-127WRKY DNA-binding protein 3