PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.C8ZMR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 184aa    MW: 20966.8 Da    PI: 6.7918
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.C8ZMRgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.61.3e-28121179159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +dDgy+WrKYG+K vk++++ r+YY+C+s+gC vkk+ver+++d ++v++tYeg Hnh 
  Aradu.C8ZMR 121 MDDGYRWRKYGKKAVKNTPNLRNYYKCSSEGCGVKKRVERDRDDSSYVITTYEGIHNHA 179
                  59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-31108181IPR003657WRKY domain
SuperFamilySSF1182909.29E-27113181IPR003657WRKY domain
PROSITE profilePS5081130.251116181IPR003657WRKY domain
SMARTSM007745.1E-33121180IPR003657WRKY domain
PfamPF031062.7E-23122178IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MDYYYVNPIN PNYGAHHDDD YSAMMSMSDF MISDFLMADD DAYGYGVDHH HHHNNQESGS  60
QSQSTNGSSE MATFSDVTTT NNNGEASSIN NNIKCKNGSK RSKKEVNSRV AFRTKSELDV  120
MDDGYRWRKY GKKAVKNTPN LRNYYKCSSE GCGVKKRVER DRDDSSYVIT TYEGIHNHAS  180
PFTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-26111181777Probable WRKY transcription factor 4
2lex_A5e-26111181777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015955985.11e-136PREDICTED: probable WRKY transcription factor 50
SwissprotQ93WU91e-40WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLG7LBB42e-64G7LBB4_MEDTR; Uncharacterized protein
STRINGGLYMA05G31800.14e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.13e-40WRKY DNA-binding protein 51