PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.C74HT
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family bHLH
Protein Properties Length: 341aa    MW: 38589.8 Da    PI: 4.8444
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.C74HTgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH284.1e-09175225454
                  HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH   4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                   h ++Er+RR++i ++f  L  ll ++ +      +K+++Le A++Y+k+L
  Aradu.C74HT 175 DHIIAERKRREKISQSFIALAALLITNIRILTIQIDKVTVLENAIKYVKDL 225
                  699***********************87666666***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474599.42E-12162238IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.538171225IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.0E-11172242IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.3E-6175225IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.09E-8176229No hitNo description
SMARTSM003535.8E-8177231IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MESSSPSWLH DLEMEDDYNN FFPKEYRMNN SIDDYDEDLF FAHDMGNSIM FESPSNNNNY  60
SSVDETSFDD ERPSKFLKTS TNTDNNSYYS SLSPNFSSLS SSSITSFQPQ ILCFDNSNSS  120
LNNNDNTTQL YDLDYTTLNT ETKLKEVVNG SSKNQNLVTK SSSKGSKRSP SNAQDHIIAE  180
RKRREKISQS FIALAALLIT NIRILTIQID KVTVLENAIK YVKDLKIRLT TLEQENNEKI  240
KEIVEEPSVI VLNKRLPHDN ESDDESVIVD NTSNHDSSSL LHHVEARVSG QHVLIRIQCQ  300
KHKGILVKLL SEIQGHNLLV LNSSALPFGD SVLDITIITR V
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179184ERKRRE
2180185RKRREK
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.C74HT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015961139.10.0transcription factor bHLH18 isoform X2
TrEMBLA0A445ESH90.0A0A445ESH9_ARAHY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2928122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22760.11e-25bHLH family protein