PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.C1QBJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 344aa    MW: 39166.1 Da    PI: 8.5758
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.C1QBJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32192246155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWt++LHe+Fve+v++LGG++kAtPk++l++m+ +gLt+ hvkSHLQkYR+
  Aradu.C1QBJ 192 KTRIRWTQDLHEKFVECVNRLGGADKATPKAVLKMMDSDGLTIFHVKSHLQKYRI 246
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.213189249IPR017930Myb domain
SuperFamilySSF466896.45E-17190246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28190247IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-23192247IPR006447Myb domain, plants
PfamPF002491.0E-8196245IPR001005SANT/Myb domain
PfamPF143793.7E-16281328IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MNENKIDYCR GMIQQSQGGL FDTIQSWNMV GGGSRPPLPP QIGPAATIMS RFESPASAFY  60
AAELCMGFAE YEHSQAQFSK MNNDNNDLEF PLYQRDKFDL SNTLQAMVNS QFNTKNQCFR  120
SSNKIPCDNF PARKFHHQQK FFTDAMASPF PNKGNQDNIV SFNSYQDRSS SPSSGGSVSA  180
NSASNGVTIS SKTRIRWTQD LHEKFVECVN RLGGADKATP KAVLKMMDSD GLTIFHVKSH  240
LQKYRIAKYM PDPIHNGKSD KRIHIENLQH QHLHLDMKSG IQIREALQQQ LDAQKLLHEQ  300
LENQRKLQLR IEEQGRQLKK MFEEQQKATN ELLSCQNIIT KDDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-23192249158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-23192249158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-23192249158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-23192249158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23192249259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.C1QBJ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015969353.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
TrEMBLA0A444YH910.0A0A444YH91_ARAHY; Uncharacterized protein
STRINGGLYMA03G29940.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-56G2-like family protein