PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.BWB05
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 208aa    MW: 23722.2 Da    PI: 9.4756
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.BWB05genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.54.9e-32132189259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYGqK+vk++++prsYYrCt ++C+vkk+ver aedp++v++tYeg+H h+
  Aradu.BWB05 132 EDGYKWRKYGQKVVKNTQHPRSYYRCTEEKCRVKKRVERLAEDPRMVITTYEGRHVHS 189
                  8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-33116189IPR003657WRKY domain
SuperFamilySSF1182904.84E-28123190IPR003657WRKY domain
PROSITE profilePS5081128.931126191IPR003657WRKY domain
SMARTSM007745.8E-36131190IPR003657WRKY domain
PfamPF031065.5E-25132188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MFEEQVMIDE IPPPLQFGCL ESLNNNNNNK AFLGAIASPP PDLVTSSCLG AAHQLLSLNR  60
STANNSWAWG QVTAEDCVMM MRVGNKRGGD VHSHVGLGIA AMKMKMKKTK VRRKVREPRF  120
CFKTMSDVDV LEDGYKWRKY GQKVVKNTQH PRSYYRCTEE KCRVKKRVER LAEDPRMVIT  180
TYEGRHVHSP SNDLQASETT SQLTDFLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-26123188974Probable WRKY transcription factor 4
1wj2_A3e-26123188974Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109115KVRRKVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945185.11e-159PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB75e-59WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A151TQX13e-79A0A151TQX1_CAJCA; Putative WRKY transcription factor 13
STRINGVIT_07s0031g01840.t014e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-50WRKY DNA-binding protein 13