PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.BU6G6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 160aa    MW: 17407.5 Da    PI: 10.9152
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.BU6G6genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.9e-3451105155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Aradu.BU6G6  51 KPRLKWTPDLHARFIEAVHQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 105
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.81248108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-3149106IPR009057Homeodomain-like
SuperFamilySSF466896.09E-1750106IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-2351106IPR006447Myb domain, plants
PfamPF002491.7E-1053104IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
GGRMYHHHHQ GKNIHSSSSR MAMSSERHMF LQAAGNGSGG DSGLVLSTDA KPRLKWTPDL  60
HARFIEAVHQ LGGADKATPK TVMKLMGIPG LTLYHLKSHL QKYRLSKNLQ GQSNNNVPHK  120
ISASSVSTGE RPSESNGTHN HMNNNTLNTI PSSPQSSNNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-2251107157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-2251107157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-2251107157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-2251107157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-2251107258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.BU6G6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0935525e-65BT093552.1 Soybean clone JCVI-FLGm-24O19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020992819.11e-110myb-related protein 2 isoform X2
RefseqXP_025683759.11e-110myb-related protein 2 isoform X2
SwissprotQ9FK475e-55PHLA_ARATH; Myb-related protein 1
TrEMBLA0A445E5451e-109A0A445E545_ARAHY; Uncharacterized protein
STRINGAES670682e-72(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.11e-51G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]