PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.B8HIV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 328aa    MW: 36081.5 Da    PI: 8.6043
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.B8HIVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-17154208256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Aradu.B8HIV 154 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 208
                  778899***********************************************98 PP

2HD-ZIP_I/II128.33.3e-41154244192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+ke +eLr +lk
  Aradu.B8HIV 154 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCDTLTEENRRLQKELQELR-ALK 244
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-18138204IPR009057Homeodomain-like
SuperFamilySSF466891.59E-18140211IPR009057Homeodomain-like
PROSITE profilePS5007117.151150210IPR001356Homeobox domain
SMARTSM003891.3E-15152214IPR001356Homeobox domain
PfamPF000464.5E-15154208IPR001356Homeobox domain
CDDcd000863.22E-15154211No hitNo description
PROSITE patternPS000270185208IPR017970Homeobox, conserved site
PfamPF021831.8E-11210244IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.7E-26210253IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MELALSLGEA PKSFTLLDNT PKLPNNKDPV GFCIVLGAAA SSAGKSSEED RRGSSDPPVQ  60
LDLLPSTPVL RSQHPSSHLR IPWLNDAQGD IGGTGGEGXX XXXXXXXXXX XXXXXXXXNG  120
GDGAAAMMRS RRDVEGGEGN DRGTSDDDEN GSTRKKLRLS KEQSAFLEES FKEHTTLNPK  180
QKLALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCDTLTEEN RRLQKELQEL  240
RALKTSQPFY MQLPATTLTM CPSCERVATN TAANNNDASQ IASALSLSNK PRILPFPNTQ  300
AHPPPAQKAH QSSSSSSSSF ATLFRLFA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152158TRKKLRL
2202210RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.B8HIV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025604520.10.0homeobox-leucine zipper protein HOX11
SwissprotP466652e-80HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A445CL660.0A0A445CL66_ARAHY; Uncharacterized protein
STRINGGLYMA09G16790.11e-128(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-64homeobox from Arabidopsis thaliana