PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.B7WMP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 96aa    MW: 10913 Da    PI: 9.6172
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.B7WMPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY955.3e-30159159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 +dDg++WrKYG+K+vk+s++pr+YY+C+s gC vkk+ver+aed ++v + Y g Hnh+
  Aradu.B7WMP  1 MDDGFKWRKYGKKPVKNSPNPRNYYKCSSVGCGVKKRVERDAEDRSYVLTSYDGVHNHQ 59
                 69********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081128.92161IPR003657WRKY domain
SMARTSM007742.1E-31160IPR003657WRKY domain
SuperFamilySSF1182909.02E-26161IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.9E-28161IPR003657WRKY domain
PfamPF031065.8E-23259IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MDDGFKWRKY GKKPVKNSPN PRNYYKCSSV GCGVKKRVER DAEDRSYVLT SYDGVHNHQI  60
PSSNSYYTTS PFSIFHSNDI NWSLHALTAN SSSSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-231621778Probable WRKY transcription factor 4
1wj2_A1e-231621778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945183.18e-67PREDICTED: probable WRKY transcription factor 50
SwissprotQ93WU98e-33WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLA0A151TQM58e-36A0A151TQM5_CAJCA; Putative WRKY transcription factor 51
STRINGGLYMA06G15220.19e-35(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.15e-34WRKY DNA-binding protein 51