PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.B3DE0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 296aa    MW: 32569.9 Da    PI: 8.7441
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.B3DE0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.1e-092764847
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Aradu.B3DE0 27 EHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 64
                     9************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.0E-132667IPR006447Myb domain, plants
CDDcd001673.47E-52765No hitNo description
PfamPF002495.3E-72764IPR001005SANT/Myb domain
SuperFamilySSF466894.44E-112770IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MVSVNPNPAQ GFYFFDPSSS NMGLPGEHDK FLEALQLFDR DWKKIEAFVG SKTVIQIRSH  60
AQKYFLKVQK NGTSEHVPPP RPKRKASHPY PQKAPKSAPT ASHVTGPLQS SSAFIEPAYI  120
YSPDSSSVLG TPVTSVPLSS WNYNTIPPSN VPPSNVPPAT KDDMGLAGAG QAVPLTCCYS  180
SSNENTPPTW PSNNGFEQRN QTKPIKVMPD FAQVYSFIGS VFDPNSTNHL QRLKQMDPIN  240
METVLLLMRN LSMNLMSPEF EDHKRLLSSY GANPEEAKFV NPCSKLLKSE SAVLTA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.B3DE0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015947786.10.0protein REVEILLE 5 isoform X2
SwissprotC0SVG57e-90RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A445EI990.0A0A445EI99_ARAHY; Uncharacterized protein
STRINGGLYMA16G03640.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.15e-82MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]