PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.AW21H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 608aa    MW: 65430.2 Da    PI: 7.0359
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.AW21HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.5e-32253310260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Aradu.AW21H 253 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 310
                  8****************************************.***************85 PP

2WRKY106.11.8e-33427485159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Aradu.AW21H 427 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 485
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.766247311IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-27247311IPR003657WRKY domain
SuperFamilySSF1182904.18E-25250311IPR003657WRKY domain
SMARTSM007742.5E-34252310IPR003657WRKY domain
PfamPF031061.1E-24253309IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-37412487IPR003657WRKY domain
SuperFamilySSF1182902.48E-29419487IPR003657WRKY domain
PROSITE profilePS5081138.825422487IPR003657WRKY domain
SMARTSM007743.1E-39427486IPR003657WRKY domain
PfamPF031063.7E-26428485IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MDSAQENSLT ELRQSSSGNA AELQSEDPNR YFPQPDAGAT SSANAGGARY KLMSPAKLPI  60
SRSPCVTIPP GLSPTSFLES PVLLSNMKGL RLKASQVEPS PTTGSLSKLH QTGHGSVTSA  120
AVSTTFPVTT VCFNTSTVDD RTSSFFEFKA HNRSNMVNAD FNNHVNEKST QIDVQGKAPC  180
FPSSPSVKSE IAVTSNELSL SSPVQMVSSG ASSHVEVDMD EFNHGGSTAS GLQASQVESK  240
SNGLSVASDR VSDDGYNWRK YGQKLVKGSE FPRSYYKCTH PNCEVKKLFE RSHDGQITEI  300
IYKGTHDHPK PQPNRRYSAG SIMSMQDERS DKVSFAGRDD KVSNIYGQVS HVAEPGSTPE  360
LSPGAASGDS PEGAGLASNK INDELDDDDP FSKRRKMDLG CADITPVVKP IREPRVVVQT  420
LSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNAGCPV RKHVERASHD PKAVITTYEG  480
KHNHDVPTAK NSSHDMAGQA ASIGQARIRP EESDTISLDL GMGLNQAAEN GSSGQGRVPL  540
SEFGGSQTHT SNSSFKFVHA TSAPVYFGVL NNGSIPSYGS RENLSDSTSL NHSTYPCPQN  600
MGRILTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-37239487377Probable WRKY transcription factor 4
2lex_A4e-37239487377Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938506.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A151S5230.0A0A151S523_CAJCA; Putative WRKY transcription factor 20
STRINGGLYMA18G09040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein