PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.AT44H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 371aa    MW: 40690.6 Da    PI: 8.8954
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.AT44HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32187240255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Aradu.AT44H 187 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 240
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15184240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28185240IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-24187240IPR006447Myb domain, plants
PfamPF002496.3E-7188239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MPLEGVFIQP PSTSASASAS ASTTCVPDLS LHISPPTTTN YAGGHHTDLS LGRREPPPPP  60
PLLPTNMNHI NEALRPIKGI PVYHNRSFPF LPMDRDHNNP NPKMCLYHHM PASSSPFPVG  120
VGLDPISFLN SGGAGGPYNN RAAATTRFNN GIPSHQHHPL HHHYGSSEMM RSRFLPKLPS  180
KRSMRAPRMR WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT  240
VKTTDKPAAS SGLSDGSGED EMSPPMGSSG MRQFQEQRGQ QDMDYSSTPT LWSNNSSSNR  300
DPWPQANSND IDGFRPISMF QSQSIGHQIQ QACDSTQIKS SLSGSNNNLE CKNPSLEFTL  360
GRPDWNGKGQ A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-17188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-17188242458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.AT44H
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956715.10.0transcription repressor KAN1 isoform X1
SwissprotQ93WJ98e-80KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A445DQC70.0A0A445DQC7_ARAHY; Uncharacterized protein
STRINGXP_004503104.11e-139(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-74G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Huang T,Kerstetter RA,Irish VF
    APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis.
    J. Exp. Bot., 2014. 65(4): p. 1181-91
    [PMID:24449383]
  3. Mach J
    Getting in Shape? Leaves work it out with KANADI1.
    Plant Cell, 2014. 26(1): p. 4
    [PMID:24464293]
  4. Jun SE, et al.
    Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12.
    Mol. Cells, 2015. 38(3): p. 243-50
    [PMID:25518926]
  5. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  6. Xie Y, et al.
    Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways.
    Plant Physiol., 2015. 169(2): p. 1240-53
    [PMID:26246448]
  7. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  8. Singh A, et al.
    Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana.
    Sci Rep, 2017. 7(1): p. 3408
    [PMID:28611467]
  9. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]
  10. Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
    Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
    Development, 2018.
    [PMID:29361563]