PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.A47FP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 403aa    MW: 44437.4 Da    PI: 9.3267
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.A47FPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.93.3e-3153111159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldD y+WrKYGqK+vkg++++rsYY+Ct +gC+v+k+ver+a++ k v++tYeg+Hnh+
  Aradu.A47FP  53 LDDAYRWRKYGQKVVKGNPNARSYYKCTAPGCSVRKHVERAATNIKSVITTYEGKHNHD 111
                  58********************************************************6 PP

2WRKY98.93.3e-31239297159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldD y+WrKYGqK+vkg++++rsYY+Ct +gC+v+k+ver+a++ k v++tYeg+Hnh+
  Aradu.A47FP 239 LDDAYRWRKYGQKVVKGNPNARSYYKCTAPGCSVRKHVERAATNIKSVITTYEGKHNHD 297
                  58********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-3438111IPR003657WRKY domain
SuperFamilySSF1182904.05E-2645111IPR003657WRKY domain
PROSITE profilePS5081133.94748113IPR003657WRKY domain
SMARTSM007749.3E-3453112IPR003657WRKY domain
PfamPF031063.3E-2354111IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-34224297IPR003657WRKY domain
SuperFamilySSF1182904.05E-26231297IPR003657WRKY domain
PROSITE profilePS5081133.947234299IPR003657WRKY domain
SMARTSM007749.3E-34239298IPR003657WRKY domain
PfamPF031063.3E-23240297IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MIYEDLKSNL FITNSDSCCR KGENEHDGHS AYGSRTVREP RVVVQTTSEI DILDDAYRWR  60
KYGQKVVKGN PNARSYYKCT APGCSVRKHV ERAATNIKSV ITTYEGKHNH DGLQHVAAQQ  120
CTGAPIRPAA VNGYSSAPNF TNSLYNPRLP ATGTQESSSL DMLQGSGLFG YTSLGRSMGS  180
YGNNTQLSDG VYIKAKDERK DDSFLEKGEN EHDGHSAYGS RTVREPRVVV QTTSEIDILD  240
DAYRWRKYGQ KVVKGNPNAR SYYKCTAPGC SVRKHVERAA TNIKSVITTY EGKHNHDGLQ  300
HVAAQQCTGA PIRPAAVNGY SSAPNFTNSL YNPRLPATGT QESSSLDMLQ GSGLFGYTSL  360
GRSMGSYGNN TQLSDGVYIK AKDERKDDSF LEKKAKKVSF IRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-3644297875Probable WRKY transcription factor 4
2lex_A7e-3644297875Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3796811e-89AB379681.1 Sesbania rostrata WRKY1 mRNA for transcription factor, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015971606.11e-131PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P59e-67WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A151RY071e-106A0A151RY07_CAJCA; Putative WRKY transcription factor 33
STRINGGLYMA18G44030.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2915822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.15e-68WRKY DNA-binding protein 33