PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.9Z8LC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 434aa    MW: 48384.2 Da    PI: 7.839
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.9Z8LCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31257311155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Aradu.9Z8LC 257 KTRIRWTQDLHEKFVECVNRLGGAEKATPKAILRLMDSDGLTIFHVKSHLQKYRI 311
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.499254314IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-28255312IPR009057Homeodomain-like
SuperFamilySSF466897.35E-17255311IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23257312IPR006447Myb domain, plants
PfamPF002493.6E-8261310IPR001005SANT/Myb domain
PfamPF143796.8E-20355401IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MNENKLDFHS EYGNHSSCQY FGIRQQPWNM GPCNNQPLSA TCVGVGVGRG RGGGGEQEVV  60
LPYSAQAKPS STIISRFESP ASAFYATEIF MGFPQYDSHQ VGNPSNLMPH QLSIKNINND  120
MEFPLYQSSK ESLFFDSSVN DQNSPNNFEL PNTLQAIKSQ WNGDQCNGSP EKSNKIPCGN  180
FPASNFLPIE QHKLFNDDAA PVTRSISIPK ANQESTVACG SFNSPVQQLS FSSPQEKLSP  240
TISAGNLVGN GPIASSKTRI RWTQDLHEKF VECVNRLGGA EKATPKAILR LMDSDGLTIF  300
HVKSHLQKYR IAKYMPESTQ GSYALPKKYF FPFSGKSEKR TSAENVHLDV KAGLQIKEAL  360
QLQLDVQRRL HEQLEIQRKL QLQIEEQGKQ LKMMFDRQQK SNNSERSSKD NNNDDNEVTI  420
LEGTGISHFP SKIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-23257314158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-23257314158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-23257314158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-23257314158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-23257314259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.9Z8LC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015939070.10.0myb family transcription factor PHL5-like isoform X1
SwissprotQ0WVU31e-67PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A445BMX40.0A0A445BMX4_ARAHY; Uncharacterized protein
STRINGGLYMA02G30800.11e-160(Glycine max)
STRINGGLYMA09G17404.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.15e-70G2-like family protein