PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.9YL2F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 294aa    MW: 35734.1 Da    PI: 6.3665
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.9YL2FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.41.1e-2445127186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k+lW+ +s++m+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++++
  Aradu.9YL2F  45 QWSIQETKEFLMIRAELDQTFMETKRNKQLWQVISNNMKEKGYHRSAEQCKCKWKNLVTRYKGCETMEPEA---MRQQFPFYNEIQ 127
                  7********************************************************************95...55689****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122035.23E-2244109No hitNo description
PfamPF138371.4E-2045129No hitNo description
PROSITE profilePS500907.31746102IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEGHHQHHQQ PQQHLLQQIL LPHHQQQNMI INVDGGGGIS DRFPQWSIQE TKEFLMIRAE  60
LDQTFMETKR NKQLWQVISN NMKEKGYHRS AEQCKCKWKN LVTRYKGCET MEPEAMRQQF  120
PFYNEIQAIF TSRSMQRMLW GEGEGTSKKN KPMQFSSEEE EEEDNDEESE EHQKGSTRMR  180
RKKKKAKISS GNNKNSGDFL NNLKEILEEF MRQQMQMEAQ WMEAFESREK ERRMKEMEWR  240
QTMEALENER IMMDQRWRER EEQWRVREEV RAQNRDELIT TLLHKLQQQS EDDF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179184RRKKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150377e-50AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015950406.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW03e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0S3RUB81e-115A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGGLYMA03G07590.21e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.17e-59Trihelix family protein