PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.9DS5H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 680aa    MW: 74604 Da    PI: 6.1006
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.9DS5HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.8e-28214267155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++F+ av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Aradu.9DS5H 214 KPRVVWSVELHQQFMAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 267
                  79*******************.********************************8 PP

2Response_reg77.25.8e-26381461109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+   y ev+ ++ +e+alell+ ++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + +  + + +  Ga 
   Aradu.9DS5H  38 VLVVDDDPTCLMILEKMLKACLY-EVTKCKCAEAALELLRGNKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKHVVMKGVTHGAC 132
                   89*****************9999.***************777778**********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   Aradu.9DS5H 133 DYLIKPVRIEALKN 146
                   **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-17714672IPR017053Response regulator B-type, plant
SuperFamilySSF521724.13E-3535156IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.6E-4135180No hitNo description
SMARTSM004486.0E-3136148IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.78737152IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.7E-2338146IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.21E-2839151No hitNo description
PROSITE profilePS5129410.888211270IPR017930Myb domain
SuperFamilySSF466895.2E-20211271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-30213272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24214267IPR006447Myb domain, plants
PfamPF002492.4E-7216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MNLSNVKGST MSTPSSSGSH LRSTGDAVSD QFPAGLRVLV VDDDPTCLMI LEKMLKACLY  60
EVTKCKCAEA ALELLRGNKN GFDIVISDVH MPDMDGFKLL EHIGLEMDLP VIMMSADDGK  120
HVVMKGVTHG ACDYLIKPVR IEALKNIWQH VVRKRKTGWR DPEQSGSIDE GDRQQKVSDD  180
ADYSSSANEG KSSKKRRDEE EDADERDDSS TLKKPRVVWS VELHQQFMAA VNQLGIDKAV  240
PKKILELMNV PGLTRENVAS HLQKYRLYLR RLSGVSQQQN NLNNSFMNPQ DPTFGSTSIN  300
GIDLQALSVA GQLPAQSLAK LQAAGLGRST AKPVMSMPLV EQRNLFSFES PKLRFGEGQM  360
QHLNTNKPIN LLHGIPTNME PKQLANLHQS AQSLGNLNMR INASVAQRSP LLMQMGQSQP  420
RGQMIGENGS HVNQLPTSLL QPTVPNRISN GVIRNGIASS SNINAAYNQV PQSSSFLNFP  480
MNQTNEMSVR SFPLGSHPGI SNITTKGMLQ EEVTSGIKGS SGFVPNYDIF NELQPQKSQD  540
WDLTTAGLTY DATQHSNHVQ GNTDVSVSPS VLVHPGFTSI QQTGQNRDTT SSMGKDMFSI  600
GEGMDQGNLQ NISQPQNPLL VDNSVRVKAE RVPDASSQTN FFPEQYGQED LMSALLKQEG  660
IGLAENEFDF DGYSLDNIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22213273464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.9DS5H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015959594.10.0two-component response regulator ARR2
RefseqXP_025694589.10.0two-component response regulator ARR2
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A444WPK30.0A0A444WPK3_ARAHY; Two-component response regulator
STRINGGLYMA15G15520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]