PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.8KH6E
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 239aa    MW: 27542.6 Da    PI: 9.0272
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.8KH6EgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.13.9e-171050242
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 +i n+s r+ tf kR++g+lKK  ELS+LC+++++ ii+s+
  Aradu.8KH6E 10 FIVNDSARKATFKKRKKGLLKKVDELSTLCGIDACAIIYSP 50
                 799*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.75149IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-23160IPR002100Transcription factor, MADS-box
CDDcd002661.19E-21285No hitNo description
SuperFamilySSF554551.07E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-171051IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MTRKKVKLAF IVNDSARKAT FKKRKKGLLK KVDELSTLCG IDACAIIYSP YDPQPEVWPS  60
PLGVQQVLSK FRRMPEMEQS KKMVNQESFL RQRIAKATEQ LKKQTKENRE KEMTQLMFQY  120
LGEGNIMHNV NMLDLNDLAY LIDQYLKDIN RRIELLTRES QSQSQPPMPP PPVVKDEVAN  180
VEEEGQGSHA QQGLNINMDS MQPKENWFVN LMSGANVDQP HVFGDANQQS GFWPNTFFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFIVNDSARKATFKKRK
22125KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956643.11e-180PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK32e-69AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV7D1F91e-120V7D1F9_PHAVU; Uncharacterized protein
STRINGGLYMA18G04760.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.17e-65AGAMOUS-like 80