PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.8JL27
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 546aa    MW: 61294.6 Da    PI: 7.7159
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.8JL27genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.34.1e-23164207245
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                  + e++snrqvt+skR+ gilKKA+ELS+LCd+++ +++fs+tgk
  Aradu.8JL27 164 KLESTSNRQVTYSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 207
                  679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.768155207IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-24155237IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-29155214IPR002100Transcription factor, MADS-box
CDDcd002665.10E-25156236No hitNo description
PRINTSPR004041.6E-17157177IPR002100Transcription factor, MADS-box
PfamPF003195.1E-20165208IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-17177192IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-17192213IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MRQKRGNECD LRVREDVVVI MAETTRATDE LAKDGVAEGI PAPPIGVSAF DLLGFLPALL  60
LHAVREASRV RVRVRRDSKV FEVSYEVIVE PGTAQPLPPP SSSFSLSLSL SLSLSLSPSV  120
SLLFFSYLTP PSHISIIPSL FFSSLHLLQY YLTRMGRVKL KIKKLESTSN RQVTYSKRKS  180
GILKKAKELS ILCDIDIVLL MFSPTGKPTL LQGERSNIEE VIAKFAQLTP QERAKRKLES  240
LEVRHSFHLT FVFSIYCAFD ASGTKENLQE IGSRCKNTRF LGFKQSNCGG INSSSKASTN  300
AANRCTSETE VQLWSFWLLN YWNNIDKINS IEHLRQMEES LRESINRVCL QKENLGKHQI  360
MSLECANQLQ DGMTLPLMMA GLQENQPLSW LLNNDNHQLM LPSEPKYLQY SDNTNREAER  420
STDVSLPGYS SYIANNGKLD SSPQVNTIGQ AGSGLNELNG TACLNIQRCE QFAYPPPPPP  480
PPDNEEVKHR TTMYNENGHD KLNTSDYQVH NGFDLPRSLF ENGHQFWNSA PGPCGVAMYN  540
ENGYHR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0532123e-87BT053212.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-G-19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015942816.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_016192178.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
TrEMBLK7MKW81e-170K7MKW8_SOYBN; Uncharacterized protein
STRINGGLYMA17G10941.11e-169(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-70AGAMOUS-like 65