PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.863B0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 567aa    MW: 61850.5 Da    PI: 7.0471
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.863B0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601154.8e-36244342199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++C+lapyfpa++p+ f++vh++FGasnv k+l++lp+++re+a++sl++eAear+ dPvyG++  +  lq+ l+q  a la +k
  Aradu.863B0 244 PCAACKFLRRKCTPECILAPYFPANNPQLFEYVHRVFGASNVGKILNELPPSQREEAVKSLAFEAEARLCDPVYGCTLQVCILQKILRQRCALLANAK 341
                  7***********************************************************************************99999888887776 PP

       DUF260  99 e 99 
                  +
  Aradu.863B0 342 R 342
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561125.26E-474156IPR011009Protein kinase-like domain
Gene3DG3DSA:3.30.200.201.1E-355110No hitNo description
PfamPF000695.8E-397154IPR000719Protein kinase domain
PROSITE profilePS5001127.347265IPR000719Protein kinase domain
SMARTSM002201.8E-337265IPR000719Protein kinase domain
Gene3DG3DSA:1.10.510.102.2E-15111158No hitNo description
PROSITE patternPS001080122134IPR008271Serine/threonine-protein kinase, active site
PROSITE profilePS5089124.632243344IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-35244338IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MHDSDRYELV RDIGSGNLGI ARLMQDKQTK ELVAVKYIER GDKIDENVKR EIINHRSLRH  60
PNIVRFKEVI LTPTHLAIVM EYASGGELFE RICNAGRFSE DEARFFFQQF ICGVSYCHAT  120
QVCHRDLKLE NTLLDGSPAP RLKICDFGYS KKPPPPTEQP ATIAAPTASL SSLSSAPLLS  180
PLLAAGNLRL SVFAAAPANL PLASPPPCRR RLLLASSDQL EVNRIQLYAE KNKKERRMSS  240
TTTPCAACKF LRRKCTPECI LAPYFPANNP QLFEYVHRVF GASNVGKILN ELPPSQREEA  300
VKSLAFEAEA RLCDPVYGCT LQVCILQKIL RQRCALLANA KRELSAYINP QAIQGPFNLQ  360
EKPLSSPAAH VGPPCSPNVV QYSPILGPSY GPDVVRSSAH LGLSDGPDDA PFFMPAMQHN  420
GSLGGGAADP QLDPGQQELL EAQQLAASAA IREQQQAIMM RNYVQQQQQE YLRHNVAAGI  480
EPVAAAAAYS GDVSGSGVFG HMGAPSGGQG GEMAPCMGLE TFDSGGSYHR QLQQPQHEVG  540
ENFVGLATQH HYPLGGQLLL PSEQQEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ujg_A2e-99116614179Serine/threonine-protein kinase SRK2E
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.863B0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020985221.10.0LOB domain-containing protein 36-like
RefseqXP_020985222.10.0LOB domain-containing protein 36-like
RefseqXP_020985224.10.0LOB domain-containing protein 36-like
TrEMBLA0A445AQ220.0A0A445AQ22_ARAHY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2905722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.19e-45ASYMMETRIC LEAVES 2-like 1