PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.7AQ1B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family RAV
Protein Properties Length: 416aa    MW: 45541.6 Da    PI: 9.4554
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.7AQ1BgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP243.57.8e-1476124155
          AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                  s+ykGV   + +grW A+I++      ++r++lg+f  ++eAa+a++ a+++++g
  Aradu.7AQ1B  76 SKYKGVVPQP-NGRWGAQIYEK-----HQRVWLGTFNEEDEAARAYDIAAQRFRG 124
                  89****9888.8*********3.....5**********99*************98 PP

2B360.72.4e-192693263996
                  EETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3  39 edesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      g++W+++++y+++s++yvltkGW++Fvk+++Lk+gD+v F+++   +++l++ +
  Aradu.7AQ1B 269 XXXXGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDTVCFHRSTGPDRQLFIDW 326
                  55789****************************************8766888787776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000184.67E-2576131No hitNo description
SuperFamilySSF541713.53E-1776132IPR016177DNA-binding domain
PfamPF008479.9E-976124IPR001471AP2/ERF domain
SMARTSM003803.8E-2877138IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.102.6E-2077132IPR001471AP2/ERF domain
PROSITE profilePS5103220.15277132IPR001471AP2/ERF domain
SuperFamilySSF1019367.65E-17216326IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.5E-6217330IPR003340B3 DNA binding domain
PROSITE profilePS5086311.209241329IPR003340B3 DNA binding domain
PfamPF023622.1E-16270327IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-20272330IPR015300DNA-binding pseudobarrel domain
CDDcd100178.07E-15273315No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048573Biological Processphotoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MDATSSVDES TTCTNDSLSI TLTPATPASP FTATSKKLSP PPPNSLCRVG SGASTIVDPD  60
VGGGVTEVES RKLPSSKYKG VVPQPNGRWG AQIYEKHQRV WLGTFNEEDE AARAYDIAAQ  120
RFRGKDAVTN FKPLGSVVSN NTAVEDEDFE SEFLNSHSKS EIVDMLRKHT YNDELEQSKR  180
SRGLIGRRLN RAAGNGGSAG MMSSSGACGG KAREQLFEKA VTPSDVGKLN RYGGEGRFAE  240
LRXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXGKVWRFRY SYWNSSQSYV LTKGWSRFVK  300
EKNLKAGDTV CFHRSTGPDR QLFIDWKARS VGNDGVGFFG PIGPVLEPVQ MVRLFGVNIL  360
KLPGSDAGDS NNNNILNINN DNNVAGSIGG CFNGKRKEME LFTLEGSKKP KIIGAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-3221433011118DNA-binding protein RAV1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1394410KRKEMELFTLEGSKKPK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences. Functionally redundant with TEM2. {ECO:0000269|PubMed:18718758}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00024PBMTransfer from AT1G25560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.7AQ1B
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn. {ECO:0000269|PubMed:18718758}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015967601.10.0AP2/ERF and B3 domain-containing transcription factor RAV1
RefseqXP_025701788.10.0AP2/ERF and B3 domain-containing transcription factor RAV1
SwissprotQ9C6M51e-112RAVL1_ARATH; AP2/ERF and B3 domain-containing transcription repressor TEM1
TrEMBLA0A444Z3B80.0A0A444Z3B8_ARAHY; Uncharacterized protein
TrEMBLA0A445CZZ20.0A0A445CZZ2_ARAHY; Uncharacterized protein
STRINGGLYMA02G11060.11e-177(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29203274
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25560.11e-108RAV family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Choi D, et al.
    iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
    Mol Plant, 2014. 7(5): p. 792-813
    [PMID:24380880]
  3. Sgamma T,Jackson A,Muleo R,Thomas B,Massiah A
    TEMPRANILLO is a regulator of juvenility in plants.
    Sci Rep, 2014. 4: p. 3704
    [PMID:24424565]
  4. Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S
    RAV genes: regulation of floral induction and beyond.
    Ann. Bot., 2014. 114(7): p. 1459-70
    [PMID:24812253]
  5. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  6. Matías-Hernández L, et al.
    TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation.
    Plant Physiol., 2016. 170(3): p. 1624-39
    [PMID:26802039]