PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.776HY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 737aa    MW: 80505.3 Da    PI: 6.2123
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.776HYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-0964883256
                 HHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox 32 eLAkklgLterqVkvWFqNrRakek 56
                 eL+k+l L++rqVk+WFqNrR+++k
  Aradu.776HY 64 ELSKRLCLETRQVKFWFQNRRTQMK 88
                 79********************999 PP

2START202.81.4e-632524781206
                  HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                  ela+ a++elvk+a+++ep+W +       e +n +e+ +++++  +     + +ea+r++++v+ ++  lv +l+d++ +W+e+++    + +t+ev
  Aradu.776HY 252 ELALGAMDELVKMAQSGEPLWIRGMemggrEVLNHEEYSRTVTPCIGlrpngFVSEASRETAIVIINSLPLVDTLMDSN-RWSEMFPcmvaRTSTTEV 348
                  57899*****************99989999999999999999998889***9***************************.****************** PP

                  ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--S CS
        START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                  issg      galqlm+aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++p++  + +v +++lpSg++i++++ng+skvtwveh+++++
  Aradu.776HY 349 ISSGingtrnGALQLMQAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIREPSSaAPTFVSCRRLPSGCVIQDMPNGYSKVTWVEHAEYDE 446
                  ************************************************************************************************** PP

                  SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 175 rlphwllrslvksglaegaktwvatlqrqcek 206
                  +++h+l+r+lv+sg+ +ga++w atlqrqce+
  Aradu.776HY 447 SQIHELYRPLVSSGMGFGAQRWIATLQRQCEC 478
                  ******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-122890IPR009057Homeodomain-like
SMARTSM003898.1E-44494IPR001356Homeobox domain
CDDcd000862.05E-94590No hitNo description
Gene3DG3DSA:1.10.10.607.4E-84997IPR009057Homeodomain-like
PROSITE profilePS5007110.8516490IPR001356Homeobox domain
PfamPF000464.5E-76488IPR001356Homeobox domain
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PROSITE profilePS5084846.852243481IPR002913START domain
SuperFamilySSF559617.56E-36245478No hitNo description
CDDcd088751.40E-123247477No hitNo description
SMARTSM002344.7E-45252478IPR002913START domain
PfamPF018523.1E-55253478IPR002913START domain
SuperFamilySSF559613.98E-24506730No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MMSNNNGLRR SREEEHESRS GSDNMDGASG DDDLDAADIN NNKPRKKRYH RHTPQQIQEL  60
EALELSKRLC LETRQVKFWF QNRRTQMKTQ LERHENTLLR QENDKLRAEN MSLREAMRNP  120
ICTNCGGPTM IGEISLEEQH LRIENARLKD ELDRVCALAG KFLGRPIPSI APHPPLPNSS  180
LELGVGNNNN SNNGSFVVGS TMPLGPDFVG MGISSNTLGV LSPTPPSRGI ATTNGMNSSN  240
TSSGYERSMV LELALGAMDE LVKMAQSGEP LWIRGMEMGG REVLNHEEYS RTVTPCIGLR  300
PNGFVSEASR ETAIVIINSL PLVDTLMDSN RWSEMFPCMV ARTSTTEVIS SGINGTRNGA  360
LQLMQAELQV LSPLVPVREV NFLRFCKQHA EGVWAVVDVS IDTIREPSSA APTFVSCRRL  420
PSGCVIQDMP NGYSKVTWVE HAEYDESQIH ELYRPLVSSG MGFGAQRWIA TLQRQCECLA  480
ILMSSAVSPP EHSAITSSGR RSMLKLAQRM TNNFCAGVCA STVHKWNKLN AGNFGEDVRV  540
MTRKSLDDPG EPPGIVLSAA TSVWLPVSPQ RLFDFLRDER LRSEWDILSN GGPMQEMAHI  600
AKGQDHGNCV SLLRASAMNS NQSSMLILQE TCTDASGSLV VYAPVDIPAM HLVMNGGDSA  660
YVALLPSGFA VAPDGSGGRN DHNTVSQSGG GSLLTVAFQI LVNSLPTAKL TVESVETVNN  720
LISCTVQKIK AALQSEG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.776HY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015961616.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A444ZLZ20.0A0A444ZLZ2_ARAHY; Uncharacterized protein
TrEMBLA0A445DDM50.0A0A445DDM5_ARAHY; Uncharacterized protein
STRINGXP_007139955.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]