PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.76148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 566aa    MW: 61093.7 Da    PI: 7.5267
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.76148genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.84.1e-32251308260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Aradu.76148 251 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 308
                  8****************************************.***************85 PP

2WRKY106.31.6e-33407465159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Aradu.76148 407 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 465
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.674245309IPR003657WRKY domain
SuperFamilySSF1182906.02E-25248309IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.7E-27248309IPR003657WRKY domain
SMARTSM007742.5E-34250308IPR003657WRKY domain
PfamPF031061.0E-24251307IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-37392467IPR003657WRKY domain
SuperFamilySSF1182902.09E-29399467IPR003657WRKY domain
PROSITE profilePS5081138.825402467IPR003657WRKY domain
SMARTSM007743.1E-39407466IPR003657WRKY domain
PfamPF031063.4E-26408465IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MDAAATITPT TSSSGSGHHA RVHEDPNPTG SGLNAEASVG GARYKLMSPA KLPISRSACI  60
TIPPGLSPTS FLESPVLLSN MKAVVSSHNE SSFLLVLALF VEPSPTTGSL PRIHQTAHGS  120
MVSAASTAFP ITSVCFHNNT VDDRKLSFFE YKPPGRSNMV PSDLNNHESE QAPRIEGPGK  180
AQPFASSPLA ESEPADPSNE LSLSSPVQKV SSVEVDLDEF NHRGNASTGL QASHVEVRGS  240
GAPIAPEKAS DDGYNWRKYG QKLVKGSEFP RSYYKCTHPN CEVKKLFERS HDGQITEIIY  300
KGTHDHPKPQ PSRRYSAGTG MSVQEERSDK ASLAGQDDRA SGMYGRGCQA ADPNSTPELS  360
PRATNDDSPE GAGFVRMELG NADITPVVKP IREPRVVVQT LSEVDILDDG YRWRKYGQKV  420
VRGNPNPRSY YKCTNAGCPV RKHVERASHD PKAVITTYEG KHNHDVPAAR SKSDTISLDL  480
GMGISSATEN RSKGISEYGE SQSQIHTNNN NFKFVHTSTP APAAYFGVLN HSSISYGSRE  540
NRNDAPSLNH SSYPCSQNMG RILTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-37251468878Probable WRKY transcription factor 4
1wj2_A1e-37251468878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015973001.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV01e-170WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLI1JJG70.0I1JJG7_SOYBN; Uncharacterized protein
STRINGGLYMA02G46690.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-171WRKY family protein