PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.75TXC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 214aa    MW: 24991 Da    PI: 9.4938
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.75TXCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY407.6e-131651982659
                  EE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  26 rCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  rCt  +C+v+k++er+ +dp+++++tYeg+Hnhe
  Aradu.75TXC 165 RCTNVKCNVRKHMERAIDDPRAFVTTYEGKHNHE 198
                  9********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF003164.4E-114381IPR033391Fructose-1-6-bisphosphatase class I, N-terminal
Gene3DG3DSA:3.30.540.103.8E-114481No hitNo description
SuperFamilySSF566551.45E-84581No hitNo description
SMARTSM007747.3E-6165199IPR003657WRKY domain
PfamPF031066.2E-8165198IPR003657WRKY domain
PROSITE profilePS5081116.8165200IPR003657WRKY domain
SuperFamilySSF1182908.63E-10165200IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-11165200IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MLQVFPSVEI LRFYEIKEEC DYLISMAKPH MQKLRVVDSE TGTKELEDVI FVKPKQQGKY  60
IIVFDPLDGS SNIESAISIG TKLLKLLLWS ERSPLLPKRR LLKKSEGNRG RRIMRKDYTI  120
SLPSILFMEK KRVEVEQESL TSLSGRYKDF IKDFISIYEL TFTTRCTNVK CNVRKHMERA  180
IDDPRAFVTT YEGKHNHEMP TKNINPDIPS ERDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.25e-14WRKY family protein