PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.7244H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 181aa    MW: 20135.7 Da    PI: 5.1967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.7244HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.79.8e-4461051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+k+C++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA ar+rdPvyG+vg i+ lq+q+ ql+ +la+++
  Aradu.7244H   6 PCASCKLLRRRCTKECIFAPYFPSDDPRKFAIVHKVFGASNVSKMLQELPIDQRGDAVSSLVYEATARVRDPVYGCVGAISYLQNQVTQLQMQLAVAQ 103
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Aradu.7244H 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5685106IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCTKE CIFAPYFPSD DPRKFAIVHK VFGASNVSKM LQELPIDQRG  60
DAVSSLVYEA TARVRDPVYG CVGAISYLQN QVTQLQMQLA VAQAEILSIH QMQQDPSNNN  120
TTLLPSQLLD QDYSEKFLLL SSAENNNNYD FLPQYLSFAS SSSSSSNVFQ DSEPLKRESF  180
C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150383e-48AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015950199.11e-132PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-70LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A151QRV19e-92A0A151QRV1_CAJCA; LOB domain-containing protein 12
STRINGGLYMA11G29450.16e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-71LBD family protein