PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.6X691
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 478aa    MW: 52981.9 Da    PI: 8.5724
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.6X691genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32245298255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Aradu.6X691 245 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 298
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15242298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28243298IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23245298IPR006447Myb domain, plants
PfamPF002499.0E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MPLEGIFMEA SSSTTPTPDL SLQISPPTIS SSSSSLICKG SSSSSSNHHN NHNNNNNNFP  60
ELSLGSNFIN YSNSSSSSSY YRAISGAHHH INYGGVSLLD ASDGGGVLRR PIKGIPVYHN  120
RSFPFMATSS SPSTMEYSRE NNKVNMCSYH HHQYMIPSSS PSSLPNNNSN YFVGPAPSSS  180
SSSSPALDPI TRLTAFKSHH HPLHHHHHEV PPSHHHHHHH HHGGFMMRSS RFLPKLPTKR  240
SMRAPRMRWT STLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK  300
TTDKPAASSD GSGDDDMSPV GGSGDCSGSL RQFSDQRGRP DRSLLQQDMD YSSTTTTLWS  360
NSSSCRETWQ QTTSDINGLR QPILHSQTKS GGQNSHIQEC DSTQLKNNLQ GSNNLECKNP  420
CLEFTLGRPD WNGKEQALYI NNLILIDLFP HSLLILCILI IYMERVVPRV QDSGDKRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.6X691
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015931635.10.0transcription repressor KAN1
TrEMBLA0A445C6E40.0A0A445C6E4_ARAHY; Uncharacterized protein
STRINGXP_007163357.11e-131(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-58G2-like family protein