PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.6X543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 189aa    MW: 20998.7 Da    PI: 8.8465
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.6X543genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.99.7e-4533131199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el++++
  Aradu.6X543  33 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRLQKELDATN 130
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  Aradu.6X543 131 A 131
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.88132133IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4433130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
KNIDLERAST TRAKKKRKSS SSIMASSSYS NSPCAACKFL RRKCMPDCIF APYFPPEEPQ  60
KFANVHKIFG ASNVSKLLNE VQPHQREDAV NSLAYEAEAR IKDPVYGCVG AISVLQRQVI  120
RLQKELDATN ADLIRYTCNE MTTLHDGRRI GEASSTFSQS PSAYYYPSPW NNDPCAGDAG  180
FHRGGGNHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-68301418119LOB family transfactor Ramosa2.1
5ly0_B8e-68301418119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.6X543
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015971507.11e-125LOB domain-containing protein 25-like
RefseqXP_025607376.11e-125LOB domain-containing protein 25
SwissprotQ8L8Q39e-70LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A445CUM11e-123A0A445CUM1_ARAHY; Uncharacterized protein
STRINGXP_007140818.11e-100(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-68LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]