PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.6H4PP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 230aa    MW: 26107.5 Da    PI: 5.1202
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.6H4PPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.66.1e-33361551128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGf F+Ptdeelv ++L +k++  +++  ++i+++d+  ++P++L+ k+ ++ +++yfFsk ++        +r+t++gyWk+ g+++++ls+  +
  Aradu.6H4PP  36 LPPGFLFSPTDEELVLHFLYAKASLLPCHP-NIIPDLDVSLAHPSQLNGKALSSGNQYYFFSKVKE--------KRITENGYWKEIGESEAILSStFE 124
                  79*************************999.89**************9777778899999999755........699****************98767 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kk Lvf+ g+ap+g +t+Wvm+ey++
  Aradu.6H4PP 125 KKVGTKKNLVFHIGEAPHGIETSWVMQEYHI 155
                  88***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-4222187IPR003441NAC domain
PROSITE profilePS5100538.80736187IPR003441NAC domain
PfamPF023655.3E-2037155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDYGSVVITI PNSTIHTYTT NSMMMMTADY ESVKQLPPGF LFSPTDEELV LHFLYAKASL  60
LPCHPNIIPD LDVSLAHPSQ LNGKALSSGN QYYFFSKVKE KRITENGYWK EIGESEAILS  120
STFEKKVGTK KNLVFHIGEA PHGIETSWVM QEYHICPSSN IISTTRARRK HDHQIWSKWV  180
LCKVYEKKGS VRGVNYCSDD DDSGTELSWL DEIYLSLDDD LEEISVSILD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-283619217170NO APICAL MERISTEM PROTEIN
1ut4_B2e-283619217170NO APICAL MERISTEM PROTEIN
1ut7_A2e-283619217170NO APICAL MERISTEM PROTEIN
1ut7_B2e-283619217170NO APICAL MERISTEM PROTEIN
3swm_A2e-283619220173NAC domain-containing protein 19
3swm_B2e-283619220173NAC domain-containing protein 19
3swm_C2e-283619220173NAC domain-containing protein 19
3swm_D2e-283619220173NAC domain-containing protein 19
3swp_A2e-283619220173NAC domain-containing protein 19
3swp_B2e-283619220173NAC domain-containing protein 19
3swp_C2e-283619220173NAC domain-containing protein 19
3swp_D2e-283619220173NAC domain-containing protein 19
4dul_A2e-283619217170NAC domain-containing protein 19
4dul_B2e-283619217170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.6H4PP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945357.11e-172NAC domain-containing protein 104 isoform X1
RefseqXP_025623561.11e-172NAC domain-containing protein 104 isoform X1
SwissprotQ8GWK61e-54NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A445B5051e-171A0A445B505_ARAHY; Uncharacterized protein
STRINGGLYMA04G38990.14e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.15e-57xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]