PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.5Z56U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 211aa    MW: 23093.1 Da    PI: 5.191
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.5Z56UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-42321311100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq q+++l+a+la+++
  Aradu.5Z56U  32 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHRVFGASNIIKFLQELPESQRADAVTSMVYEAGARIRDPVYGCAGAICQLQTQVNELQAQLAKAQ 129
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Aradu.5Z56U 130 AE 131
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.21931132IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4232129IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MEASDTNTPI SSSQSPTSSS SLPPPPQVIM SPCAACKILR RRCAEKCVLA PYFPPTEPAK  60
FTTAHRVFGA SNIIKFLQEL PESQRADAVT SMVYEAGARI RDPVYGCAGA ICQLQTQVNE  120
LQAQLAKAQA EIANMQFQQA NMVALLYMQM AEANNKATAT TQEPPPSPQQ SVDNFIASPP  180
HINNNLNFFD DNNTSLNSMW ELFGHDHITT F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-413113210111LOB family transfactor Ramosa2.1
5ly0_B3e-413113210111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.5Z56U
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935738.11e-156LOB domain-containing protein 1-like
SwissprotQ9SK082e-74LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A445BVT91e-126A0A445BVT9_ARAHY; Uncharacterized protein
STRINGGLYMA13G40370.21e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-63LOB domain-containing protein 1