PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.5F7WV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WOX
Protein Properties Length: 420aa    MW: 46706.3 Da    PI: 7.466
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.5F7WVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.5e-1852112257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Aradu.5F7WV  52 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRMQLqeygQVGDANVFYWFQNRKSRSKH 112
                  89*****************99*************************************995 PP

2Wus_type_Homeobox1123.1e-3651113264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+++L+eyG+++d+NVfyWFQNrk+R+++k
        Aradu.5F7WV  51 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRMQLQEYGQVGDANVFYWFQNRKSRSKHK 113
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-741111IPR009057Homeodomain-like
SuperFamilySSF466894.06E-1246115IPR009057Homeodomain-like
PROSITE profilePS5007110.4348113IPR001356Homeobox domain
SMARTSM003891.9E-850117IPR001356Homeobox domain
CDDcd000862.10E-851113No hitNo description
PfamPF000462.3E-1552112IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNQF QHDMVSTTTA SCHRSAPYNP ISGCDEKSPE PKPRWNPKPE  60
QIRILEAIFN SGMVNPPRDE IRKIRMQLQE YGQVGDANVF YWFQNRKSRS KHKLRHLTNN  120
NSRNNNTPSP SPPPPLPPQQ QFISATTNSS SSSSSDKSSP KFVPAFTDVV MLLPNSPTAS  180
VNQNYFHHND TNNNNTINHL LVPPPLPIEP FFPVFHNSSG VVATTEISNS VGNHHQPPHL  240
VYQENVDPCT DLLLSEIMSH GGVEPSSKRY HEQDKAAATV KIRQPQQYIS FCPVSTPPPS  300
FTNTTATPIT VPSPFQARFN LYAFYVHMRL DSVWCVSGAG GGCGSGDASA AKCTVYINDM  360
ACEVDVGPFN VRHAFGDEAV LIDSSGHTVL TDDWGVTLHP LQHGFSYYLI WFLSFFLSPP
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.5F7WV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020994701.10.0WUSCHEL-related homeobox 8-like isoform X2
TrEMBLA0A445DQU30.0A0A445DQU3_ARAHY; Uncharacterized protein
STRINGXP_007148089.11e-113(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.16e-58homeobox-3