PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.4HX8U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 279aa    MW: 30717.8 Da    PI: 6.0768
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.4HX8UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.7e-332376255
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 prlrWt++LHerFv+av+qLGG+ kAtPk+il++m+vkgLtl+h+kSHLQkYRl
  Aradu.4HX8U 23 PRLRWTTDLHERFVDAVTQLGGATKATPKAILRTMNVKGLTLYHLKSHLQKYRL 76
                 8****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.1921979IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-312077IPR009057Homeodomain-like
SuperFamilySSF466894.84E-162378IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-232377IPR006447Myb domain, plants
PfamPF002494.4E-82475IPR001005SANT/Myb domain
PfamPF143794.0E-9116161IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MFSRLVHPCG GGGDGDGVEE MMPRLRWTTD LHERFVDAVT QLGGATKATP KAILRTMNVK  60
GLTLYHLKSH LQKYRLGKQS GKDFDEGCKD ASYPLESPST NNSSPKASYD ANEGQEVKEA  120
LRAQMEVQSK LHLLVEAEKH LLICQDAEQT YMVMLERACK MLADQIISNP MVDTGSQRLE  180
GLHVSEVLVP SLILLPQGTE SCLTSLENLG GLTLEGSPSG ARKRILNLDS VVAPLMWNEA  240
NMRTQGIHSS QVNPHHEITG YEYYTSDQDG AGHPCTFVH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-192478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-192478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-192478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-192478357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-192478458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.4HX8U
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015941158.10.0protein PHR1-LIKE 2 isoform X2
SwissprotQ94A578e-50PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A445BGV01e-180A0A445BGV0_ARAHY; Uncharacterized protein
STRINGGLYMA20G33540.21e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-52G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]