PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.456GX
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 344aa    MW: 38890.2 Da    PI: 5.4359
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.456GXgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY57.72.4e-182132541859
                  -SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  18 sefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  s++ rsYYrCtsa+C+vkk+vers +dp+vv++tYeg+H h+
  Aradu.456GX 213 SKYFRSYYRCTSASCNVKKRVERSFTDPSVVVTTYEGQHIHP 254
                  7899*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081118.682203256IPR003657WRKY domain
SMARTSM007741.3E-12208255IPR003657WRKY domain
PfamPF031061.3E-12209254IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.1E-16212256IPR003657WRKY domain
SuperFamilySSF1182903.66E-14213256IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEKDNMDLKK TEDAVAFGSS NGYYNNPLLL SSAFDFSCEV EKSSFMELLG VQDYYNNSGA  60
VLDLPQLSKA TVLPFTTVNA SCDDTAKECS EVLNQKHQPA TPNSSSISSA SSEAVNDEHN  120
KIVEQDDDDS EEDEEEEEQL KETKKEWLGR FYYKMRFDGP FDWALKVEGK EDKAEETERT  180
EIRVHDEKRG RSSGRRLQME KVRSKGCQKQ PLSKYFRSYY RCTSASCNVK KRVERSFTDP  240
SVVVTTYEGQ HIHPSPVMPR SAIAGVGSPM IPPAVSTPNL GPLMPGNYMS HYHQHRHHHQ  300
QLLVNTLFSL GIPYNNSNNI DNSSFSQDNG LLQDIVPSHM LKEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5876974e-89KM587697.1 Glycine max clone GmWRKY3 WRKY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015939429.11e-150PREDICTED: probable WRKY transcription factor 23
TrEMBLG7ICW17e-72G7ICW1_MEDTR; Uncharacterized protein
STRINGGLYMA02G01420.13e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.12e-19WRKY DNA-binding protein 48