PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.3G2QU
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SBP
Protein Properties Length: 1051aa    MW: 116438 Da    PI: 8.1909
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.3G2QUgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.82.1e-40118195178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dls+ak+yhrrhkvCe hska+++ + +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  Aradu.3G2QU 118 MCQVDNCKEDLSSAKDYHRRHKVCELHSKASKAPLGNQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 195
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.1E-34113180IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.641116193IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-37117197IPR004333Transcription factor, SBP-box
PfamPF031105.8E-30119192IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.99E-5838934IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.7E-5838934IPR020683Ankyrin repeat-containing domain
CDDcd002041.34E-4843935No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1051 aa     Download sequence    Send to blast
MEKVAPPIFM HQALQSRFCD VPMTTTATTK KRDLSYDVDK SSSNGNWNPN AWSWDSVRFI  60
GKPVPQQNGV VSVEEETLRL NLGSSGVSGS GGSVDPSVSR PSKRVRSGSP TGTASYPMCQ  120
VDNCKEDLSS AKDYHRRHKV CELHSKASKA PLGNQMQRFC QQCSRFHPLT EFDEGKRSCR  180
RRLAGHNRRR RKTQPEDVTS QPESVATGNA EIFNLLSAIA SSQGQKPNGT VFLIRAINIA  240
MLVDDNDRKF EDRSKIASQV PDKDQLVQIL NRIPLPADLA AKLLNVGGKG QIQTSSYHHD  300
KVNQSNSGPL TKDLLAVLST TLSASTPNSQ KSSQSSDSEK SRASADQVGE SLQMRQHPQE  360
FASVGDERSS GSSQSPVEDS DFPEVQVNLP LQLFSSSPEV GNPPKLTPSQ KYFSSDSSNP  420
VEERSPSSSP AVDNQFDLQG VARGFKADGV PSRREVNANK EASQSQSYNI SLNLFNAPNS  480
RVQPSSLQSV PFQAGYASSG SEHSPPSLNS DAQDRTGRIM FKLFDKDPSH FPGTLRTQIY  540
NWLSNSPSDM ESYIRPGCVV LSLYASMSSA AWEQLEENFL QHVHSLIQSN SDFWRIGRFL  600
VHSGNQLALH KDGKIHLCKP WRTWRSPELI SVSPLAIVSG QETSFSLKGR NLSNPGTKIH  660
CTGTGGYMPI KVVESACHGM TYDKIKLSGI KVQDASSGHL GRCFIEVENG FKGNSFPVII  720
ADATICKELR PLESEFNKEE NASDAISDEH GYDLGRPRSR EETLHFLNEL GWLFQRERFS  780
YTDLVPDYSL DRFRFILTFS VERNCCMLVK TLLDMLVQKY LEGQWSSTAS LEMLNAIQLL  840
NRAVKRKYVN MVDLLIQYAV PSKNDASRKY VFPPNVAGPD GITPLHLAAC TSSSEGVIDS  900
LTNDPQEIGL NSWDSLLDAN GQTPHAYAMM RNNHSYNVLV ARKLSDRRRG HVSVTINSEI  960
EHSSMDIELK QRQSDQTKRG QNSCTKCSAM ADVRYSSRIP GSRSFGHHRP FIHSILAIAA  1020
VCVCVCLFLR GHPWVGSVTP FNWEKLDYGT I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31110192284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.3G2QU
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF3122330.0KF312233.1 Arachis hypogaea squamosa promoter-binding-like protein (SPL14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015946871.10.0squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A445B0Q90.0A0A445B0Q9_ARAHY; Uncharacterized protein
STRINGGLYMA20G00900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]