PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.31JVP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TCP
Protein Properties Length: 148aa    MW: 15878.9 Da    PI: 8.6737
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.31JVPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP110.72.1e-341482472
          TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72
                   ++++++hTkv+gR+RRvR++ +caar+F+L++eLG+ +d++tieWLl+ a+p+i+++tgt++ +a  
  Aradu.31JVP 14 SSRSNKDRHTKVNGRGRRVRMPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAATGTGTVPAAP 82
                 67899*********************************************************6655522 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.9E-3017112IPR005333Transcription factor, TCP
PROSITE profilePS5136927.0251872IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
LRKSSGAGAL STTSSRSNKD RHTKVNGRGR RVRMPPLCAA RIFQLTRELG HRSDGETIEW  60
LLRHAEPSII AATGTGTVPA APPSASATPT MVCAGGSQWP SCRLDLCQPP PGMEYASVNG  120
HRYMPFTSLL LQPATADESQ HEEALSDQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.31JVP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150412e-48AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025635107.14e-95transcription factor TCP11-like
RefseqXP_025663894.14e-95transcription factor TCP11-like
SwissprotQ9SJK75e-41TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A394DAP53e-66A0A394DAP5_LUPAN; Uncharacterized protein
STRINGXP_004497526.13e-64(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.16e-37TCP family protein