PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.30PYG
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 861aa    MW: 93608.5 Da    PI: 6.3715
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.30PYGgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.2e-21153208156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Aradu.30PYG 153 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 208
                  688999***********************************************999 PP

2START198.82.4e-623725974206
                  HHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   4 eeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ++a++elvk+a++ ep+W +s      e +n +e++++f+           + +ea+r++g+v+ ++  lve+l+d + +W e+++    + +t+evi
  Aradu.30PYG 372 LAAMDELVKMAQSCEPLWIRSLeiggrEVLNHEEYIRTFPNP-CialrtnsFVSEASRETGLVIINSLALVETLMDAN-RWAEMFPcmiaRTSTTEVI 467
                  789************************9***********664.259999999**************************.******************* PP

                  CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--S CS
        START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                  s+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++   + +v +++lpSg+++++++ng+skvtwveh+++++
  Aradu.30PYG 468 SNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDAIRETSSagAPTFVNCRRLPSGCIVQDMPNGYSKVTWVEHAEYEE 565
                  ********************************************************9999999*********************************** PP

                  SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 175 rlphwllrslvksglaegaktwvatlqrqcek 206
                  r +h+l+r l++sg+a+ga++w atlqrqce+
  Aradu.30PYG 566 REVHQLYRALLSSGMAFGAQRWIATLQRQCEC 597
                  ******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-21135210IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-22138210IPR009057Homeodomain-like
PROSITE profilePS5007117.556150210IPR001356Homeobox domain
SMARTSM003893.8E-17151214IPR001356Homeobox domain
CDDcd000862.78E-18152210No hitNo description
PfamPF000463.1E-18153208IPR001356Homeobox domain
PROSITE patternPS000270185208IPR017970Homeobox, conserved site
PROSITE profilePS5084844.034360600IPR002913START domain
SuperFamilySSF559615.68E-34361597No hitNo description
CDDcd088752.04E-120364596No hitNo description
SMARTSM002341.1E-43369597IPR002913START domain
PfamPF018527.0E-54372597IPR002913START domain
SuperFamilySSF559612.53E-19625854No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MSFGGFLDNN SGGGDDGGGG GGVRNIVEIP YNNGGGGTTK NNIINNDNNR TTMPSGAISQ  60
PRLLTTTPTL AKSMFNSPGL SLALQQTNLD GQGDVNNNNI MGSENNNNNY EGSNGGLRRS  120
REEEHESRSG SDNMDGASGD EQDAADNNNP KRKKRYHRHT PQQIQELESL FKECPHPDEK  180
QRLELSKRLC LETRQVKFWF QNRRTQMKTQ LERHENTLLR QENDKLRAEN MSIRDAMRNP  240
MCSNCGGPAI IGELSLEEQH LRIENARLKD ELDRVCALAG KFLGRPISSM GGPHPLPNSS  300
LELGVGNNNN GYGCNLSINV PNSLPLGPEF GVNLSSPLGM VSGPAITRPQ PSAVVGGFDR  360
SMERSMLLEL GLAAMDELVK MAQSCEPLWI RSLEIGGREV LNHEEYIRTF PNPCIALRTN  420
SFVSEASRET GLVIINSLAL VETLMDANRW AEMFPCMIAR TSTTEVISNG INGTRNGALQ  480
LMHAELQVLS PLVPVREVNF LRFCKQHAEG VWAVVDVSID AIRETSSAGA PTFVNCRRLP  540
SGCIVQDMPN GYSKVTWVEH AEYEEREVHQ LYRALLSSGM AFGAQRWIAT LQRQCECLAI  600
LMSSTQPSRD HSAITASGRR SMLKLAQRMT NNFCAGVCAS TVHKWNKLNN TGNTXXXXXX  660
XXXXXXXIVL SAATSVWLPV SPQRLFDFLR DERLRSEWDI LSNGGPMQEM AHIAKGQDHG  720
NCVSLLRAGA INSNQSSMLI LQETCIDAAG SLVVYAPVDI PAMHVVMNGG DSAYVALLPS  780
GFAIVPDGPA PRGAQNGGAD ANGGDDLGGG ARGSGSLLTV AFQILVNSLP TAKLTVESVE  840
TVNNLISCTV QKIKAALRCE S
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.30PYG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020991942.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A445EGZ00.0A0A445EGZ0_ARAHY; Uncharacterized protein
STRINGXP_007134961.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]