PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2Z03S
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 374aa    MW: 42006.1 Da    PI: 8.9593
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2Z03SgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.9e-32157210255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Aradu.2Z03S 157 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 210
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15154211IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-28155211IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23157210IPR006447Myb domain, plants
PfamPF002492.5E-7158209IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MLTNSLPSIM QTLLASSPPK FQGPDLSLNI SPPCVSVSDS ENNNLNNNNN NMNMNMNMNM  60
FLSSRKKIVY NDISTSSTTS DSGGSSCGSA SDLSHENNNL LHHQPTLTLD LNNYHHHHQG  120
LSRSFNNHHH FQPQIYGREF KRSSRVINGV KRSVRAPRMR WTTTLHAHFV HAVQLLGGHE  180
RATPKSVLEL MNVKDLTLAH VKSHLQMYRT VKSTDKSTGH GQTDMGLIPM PRINNVAHLH  240
ANNGVSASHD DRPNNLPHPP QNYSQRSWQS SIMEANTNNS RQKPQLGLTD SHTKGYETMV  300
EEHNCVGMSN CMKENKLDST SLSSSDELML DLEFTLGRPN WEKEHQKESS RVELTLLKCS  360
INLTNHLISL SLKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-17158212458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.2Z03S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015972597.10.0probable transcription factor KAN4
TrEMBLA0A151R6J51e-114A0A151R6J5_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA17G36500.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.13e-58G2-like family protein