PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2T85U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 794aa    MW: 86835.5 Da    PI: 6.1849
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2T85UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-2197152156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  Aradu.2T85U  97 KKRYHRHTPHQIQELETFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 152
                  678899***********************************************999 PP

2START1831.6e-573075302206
                  HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
        START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                  +a++a++el+k+a+a++p+W k      e +n +e+ + f +  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a tl+vis
  Aradu.2T85U 307 VALAAMDELIKMAQADSPLWIKGFdgerEVLNHEEYARVFNPCIGpkpagYVTEATRETGIVIINSLALVETLMDAN-RWLEMFPsmiaRAVTLDVIS 403
                  7899******************99888888999999999988888********************************.******************** PP

                  TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
        START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp 177
                  sg      galqlm +e q+lsplvp R + f+R+++q+ +g+w++vdvSv+  ++  + ++++ +++lpSg+++++++ng+skvtwveh+ ++++++
  Aradu.2T85U 404 SGmggtrnGALQLMHSEIQLLSPLVPiRQVRFLRFCKQHAEGVWAVVDVSVEIGRDAANAQPFMSCRRLPSGCVVHDMPNGYSKVTWVEHWQYDDSVV 501
                  *********************************************************99*************************************** PP

                  HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 178 hwllrslvksglaegaktwvatlqrqcek 206
                  h+l+r+l++sg  +ga +w atlqrqce+
  Aradu.2T85U 502 HQLYRPLINSGFGFGAHRWIATLQRQCEC 530
                  ***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-2281148IPR009057Homeodomain-like
SuperFamilySSF466892.26E-2083154IPR009057Homeodomain-like
PROSITE profilePS5007117.71894154IPR001356Homeobox domain
SMARTSM003895.2E-1995158IPR001356Homeobox domain
CDDcd000867.71E-1996154No hitNo description
PfamPF000468.7E-1997152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PROSITE profilePS5084841.486297533IPR002913START domain
SuperFamilySSF559611.33E-31298530No hitNo description
CDDcd088751.10E-120301529No hitNo description
SMARTSM002347.0E-40306530IPR002913START domain
PfamPF018521.8E-48307530IPR002913START domain
SuperFamilySSF559611.1E-21558788No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MGFEGSISTN SGNSNRAVLN DISQPIPSSL QNPSSFSFSA QRKMEGHGDM GLIGENFDTS  60
LIGRLRDDEY ESRSGSDNFE GASGDDQDAG DDQPRRKKRY HRHTPHQIQE LETFFKECPH  120
PDEKQRLDLS KRLGLENKQV KFWFQNRRTQ MKTQLERHEN IMLRQENEKL RAENSLMKEA  180
MSNPVCNNCG GPAIPGQISF EEHQIRIENA RLRDELNRIC ALANKFLGKP ISSLTNPMAL  240
PTSNSGLELG IGRNGIGVSS PFGAPLQMGL DLGDGVLGTQ PAISGMKSPL GLMGNDVQLE  300
RSMLVDVALA AMDELIKMAQ ADSPLWIKGF DGEREVLNHE EYARVFNPCI GPKPAGYVTE  360
ATRETGIVII NSLALVETLM DANRWLEMFP SMIARAVTLD VISSGMGGTR NGALQLMHSE  420
IQLLSPLVPI RQVRFLRFCK QHAEGVWAVV DVSVEIGRDA ANAQPFMSCR RLPSGCVVHD  480
MPNGYSKVTW VEHWQYDDSV VHQLYRPLIN SGFGFGAHRW IATLQRQCEC LAILMSSSIS  540
SDDHTALSQA GRRSMLKLAQ RMTSNFCSGV CASSARKWDS LHIGTLDDDM RVMTRKNVDD  600
PGEPPGIVLS AATSVWVPVS RQRLFEFLRD ERLRSEWDIL SNGGPMQEMV HIAKGQGHGN  660
CVSLLRANGV NANDSSMVIL QETWTDASCS VVVYAPVDVP SLNVVMSGGD SAYVALLPSG  720
FAILPDGHSS SGSNGNLAKG GSSSDEGGGS LLTVGFQILV NSLPTAKLTV ESVDTVNNLI  780
SCTIHKIKAA LTLS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.2T85U
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015941562.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
RefseqXP_025620152.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A444XX530.0A0A444XX53_ARAHY; Uncharacterized protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]