PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2SS2B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 748aa    MW: 81760.4 Da    PI: 6.9262
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2SS2BgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.3e-32270327260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ d++++ei+Y+g+Hnh+k
  Aradu.2SS2B 270 EDGYNWRKYGQKQVKGSEYPRSYYKCTQPNCQVKKKVERSH-DGQITEIIYKGTHNHSK 327
                  7****************************************.***************85 PP

2WRKY104.17.7e-33483541159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+++++k+v++tYeg+Hnhe
  Aradu.2SS2B 483 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERASHNTKYVITTYEGKHNHE 541
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-28260328IPR003657WRKY domain
PROSITE profilePS5081123.835264328IPR003657WRKY domain
SuperFamilySSF1182901.07E-25267328IPR003657WRKY domain
SMARTSM007749.9E-36269327IPR003657WRKY domain
PfamPF031064.3E-25270325IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.0E-36468543IPR003657WRKY domain
SuperFamilySSF1182901.57E-28476543IPR003657WRKY domain
PROSITE profilePS5081137.734478543IPR003657WRKY domain
SMARTSM007743.3E-38483542IPR003657WRKY domain
PfamPF031062.6E-25484541IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MDSDSKGGIF PAFPVKRSIA ERRGFNSNAA RINTARFRTN TITTSPLASP SPSSCSASPC  60
ITIPPGISPT ALLDSPIMLP NSQILSCWVC CVYLFIYFSF FFAMPSPTTG SFHWLSSLPL  120
DQGNLNDAPD SSLKFKNNAT LADPNPLPPY SASLNQVSSN WHMVKGGNTD CQSIVPVLPP  180
IDFSFPEDFS KGQNAKIIES RSFNDVKMVN CSLVNVNKVE MMQISRSDEA GDESTLPKNV  240
TLGGDIGRQP VMEKDQKETL LATGVVRTSE DGYNWRKYGQ KQVKGSEYPR SYYKCTQPNC  300
QVKKKVERSH DGQITEIIYK GTHNHSKPHL GRRASGLSTD EMSDMGEAGE NYAKLEGSGW  360
KNVQPGAKDT KHGLDWKADG LERTSSTSVV TELSDPMSTN KGKPLCAFEA EDTPEHSSTL  420
ASNDGDEDGT TQALAPAEDD AEDDESDSKR RKKENYLVES TLPSRAVREP RVVVQIETEI  480
DILDDGYRWR KYGQKVVKGN PNPRSYYKCT SAGCPVRKHV ERASHNTKYV ITTYEGKHNH  540
EVPTARTNNH VSSNDGGLPP SGPNGQSALA LPGSAVIPKS ENHQTLTSHF DRKPEFGSDF  600
LRPSLVGAFS NNLKFGSSPM CQMKYPSLSS TMPYSSFGLN PDRCTAPQAG SIPSVYPDFP  660
MPLPLNLPSS GNFSLAGLNF NCAKPMNPVQ PFLSGQQVKD IDTGFLRPKQ EQKDDAIYGT  720
CLPPVDHGNS SSAAPSSIYQ QVMQNFPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-32262543577Probable WRKY transcription factor 4
1wj2_A3e-32262543577Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015962000.10.0PREDICTED: WRKY transcription factor SUSIBA2-like
TrEMBLV7B1N40.0V7B1N4_PHAVU; Uncharacterized protein
STRINGGLYMA18G47741.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83493445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-84WRKY DNA-binding protein 2