PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2S5CB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 325aa    MW: 37173.9 Da    PI: 9.4193
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2S5CBgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY60.14e-19213269259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  dDgy+WrKY   + +   +  s+YrC++++C+vkkkver+   ++++++ Y+g+H h+
  Aradu.2S5CB 213 DDGYSWRKYEENPLRRRGNQISFYRCSHPNCKVKKKVERTI-GGEIIHVNYKGTHAHR 269
                  8****************************************.***************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081114.366207268IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-16208269IPR003657WRKY domain
SuperFamilySSF1182906.28E-15210269IPR003657WRKY domain
SMARTSM007749.9E-12212270IPR003657WRKY domain
PfamPF031063.4E-15213268IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005794Cellular ComponentGolgi apparatus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MPTQNSYHLN QKRLWRFVGF MSCANGFLCY AKSSSFKHLF GEWNLLKIIL YTLLSFSIST  60
IMLFPKKCRL SRSFLLKAYV GVLVLLLTSL YSFFSDKSDN GKPDLLSMIS NVSFALMSLS  120
LSRQIDLGFE AELLNFFLGC LTIQLMKISL MLSIVAAIFC YSLMILRSKS ESQSHVRTLR  180
MQDHVTVDID AANDDYLNAF QWSNDDGKKQ MQDDGYSWRK YEENPLRRRG NQISFYRCSH  240
PNCKVKKKVE RTIGGEIIHV NYKGTHAHRN CKPKFPIKRN SSSESFYSLL PSEPSHTKII  300
DQSLAFNGDG QLDHDTAPES SSLSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015931917.10.0PREDICTED: uncharacterized protein LOC107458235
TrEMBLG7IXC71e-127G7IXC7_MEDTR; Uncharacterized protein
STRINGGLYMA14G37960.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF147431012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.19e-15WRKY DNA-binding protein 33