PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2AC1F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 724aa    MW: 78199.5 Da    PI: 7.2968
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2AC1FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.82e-22190243155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+++ Wt+ LH+ F+ a++++ G++kA+Pk+ile+m+v+ Lt+e+v+SHLQkYR+
  Aradu.2AC1F 190 KKKIIWTNYLHNLFLLAIRHI-GIHKAVPKKILEVMNVPNLTRENVASHLQKYRI 243
                  67999****************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.227187246IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.8E-23188247IPR009057Homeodomain-like
SuperFamilySSF466897.17E-17189247IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-24190243IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MFKVLSANIH SAMPKSFVAG PSLHMLRPIT WNDRPAPRND NKLVPEPKSA LIPAPALFDL  60
SISVAVPAPV LAPTPALVLA QGTAPVSAPA QVSTPAPEPA PVLAQRPAPA SAPTLAQGPA  120
LSPVSTPTPA WAPAPILTLA PAAIENSLEK EGQEELSPSR SAPSSKKSKA NKEKKRKGSE  180
VAASAPKKPK KKIIWTNYLH NLFLLAIRHI GIHKAVPKKI LEVMNVPNLT RENVASHLQK  240
YRIFLRKIAE KGIIAGISDR TLRSRFAAEL PIKMIRALQA LYEKLKNNNN FGTPLPISLI  300
QALLDYHHPY NPNFPYLIPT NNNTALNQVM SLGVAPQFLG PKAPIGNANN NTMIHHQLPI  360
YAPYDPVMHH QNYAQSPMGI NNNHQQQSYD PRVYHQSYDL GKGNMVSLGN PNVNNNIPMM  420
NAAPSCYPSV PPAGIHNQMK YNYGVQGHGG FNGVGVGGAT TNAVPIPIPI SNNHYNSNVN  480
GFEFMDGAPI NNVNVGAFGN NGNYPASVQG CYVPPGFYAP PPSPECYGSP SHPPRTGYYA  540
PPPPPPATAA NNNLTIIDEL SAMLLHHAAA QKNSGGIQDQ DLPPLVESPC DSNEEHSKNA  600
SAINEDQSIL DDDYVLSNLL FMLEDMHILK EYDQAAEKQD GKEFFKPHLS TSSNVVQSPE  660
QVGGNQVPDD FFDFSGSANL IQQGDNEFLD IEISDEMFTT TNNGSPITSN YSVSKQARLG  720
QDPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20184249164ARR10-B
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174189KRKGSEVAASAPKKPK
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.2AC1F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020999773.10.0uncharacterized protein LOC110281833
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101422534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07210.12e-26response regulator 21