PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2A606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 121aa    MW: 13599.1 Da    PI: 7.6309
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2A606genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.43.8e-2969118251
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ
  Aradu.2A606  69 PRLRWTPDLHLRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ 118
                  8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2565118IPR009057Homeodomain-like
PROSITE profilePS5129410.55965121IPR017930Myb domain
TIGRFAMsTIGR015573.8E-2169119IPR006447Myb domain, plants
SuperFamilySSF466892.69E-1369119IPR009057Homeodomain-like
PfamPF002494.5E-970118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MEESHGSQCS KTSPSNLEEE EEDDDDKYEI NKNNGGGGGG CSSNSTVEEN SNNNNDKKKI  60
RPYVRSKFPR LRWTPDLHLR FLHAVQRLGG QERATPKLVL QLMNIKGLSI AHVKSHLQVI  120
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1770118351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1770118351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1770118351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1770118351Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1770118452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.2A606
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015950480.11e-81two-component response regulator ORR22-like
RefseqXP_025655483.11e-81two-component response regulator ORR22
SwissprotQ700D99e-26MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A445EAY22e-80A0A445EAY2_ARAHY; Uncharacterized protein
STRINGGLYMA01G31044.11e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein