PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.26X49
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 702aa    MW: 77205.6 Da    PI: 5.7282
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.26X49genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.2e-29221274155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Aradu.26X49 221 KPRVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 274
                  79*******************.********************************8 PP

2Response_reg40.71.2e-142193179
                  EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEES CS
  Response_reg  1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvta 79
                  vl vdD+p+ +++l+++l+k +y       ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+v++
   Aradu.26X49 21 VLAVDDDPTCLKVLENLLRKCQY-------QAIEALRMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMVSS 93
                  799********************.......455688888777777*******************87754.558******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.4E-2718154IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.1E-3318167No hitNo description
SMARTSM004485.0E-2319145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011032.2520149IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.0E-122193IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.21E-2222148No hitNo description
Gene3DG3DSA:1.10.10.601.7E-30218278IPR009057Homeodomain-like
PROSITE profilePS5129412.169218277IPR017930Myb domain
SuperFamilySSF466895.91E-20219278IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25221274IPR006447Myb domain, plants
PfamPF002491.2E-7223273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
QRWLKMTVED QIDRFPVGMR VLAVDDDPTC LKVLENLLRK CQYQAIEALR MLRENRNKFD  60
LVISDVNMPD MDGFKLLELV GLEMDLPVIM VSSLSYWCGG DQYLESHACL LSGHSDTKLV  120
MKGVTHGAVD YLLKPVRIEE LKNIWQHVVR RKNFDPRDQN KGSNDKRGPN AAGEGNQSII  180
SEDGSDQNKN LGKKRKDQTE EEEDDGEDNG EDNDDPSSQK KPRVVWSVEL HRKFVAAVNQ  240
LGLDKAVPKK ILDLMNVEGL TRENVASHLQ KYRLYLKKAT QQASMVAALG NTESYLRIGS  300
IDAYAEFCTS SGPGKIPNPA LQSYASSGIF GRLNSPANLS MRGISASTLI QPPVQPQNLN  360
STLSPLGNIQ ASIFPANQTS SLLQGIPTSI ELNQSKQNNC TTGITQVNQV SCSGFTAASG  420
FRDRRLTVGT ASNALPSAAC NSPQTHNSGA FRNQPPVRPA SLGTDSFDAG ICGPSNMLDY  480
NRCNKNWQNA EQLSKLPANP LPLCEPFNND PLPPTGINVA NTSTRIGNSP VDYSSRVAIS  540
VPLEDTRNEL QRQEGLIENI VQPSSYTTPS QRWEEHKLEY SQNMSRPFNS VNSHVSSSRV  600
TSSLGHNLNQ TNAACSNSVD ASFVGQLSGA PPSIIQCTNV DTRLKSNDAY MLELMKSRDG  660
FIQNNFGTLD DIMVPMVKRE QNEPTFIDGE MGFEAYPVGS CI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25217280164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.26X49
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015954155.10.0two-component response regulator ARR12 isoform X2
TrEMBLA0A445DY420.0A0A445DY42_ARAHY; Two-component response regulator
STRINGGLYMA09G14650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-116response regulator 12