PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.262YC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 254aa    MW: 28453.8 Da    PI: 8.3106
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.262YCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601452.2e-45131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+ +la+++
  Aradu.262YC  13 PCAACKLLRRRCAADCVFAPYFPADEPHKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQIQLAVAQ 110
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  +e
  Aradu.262YC 111 AE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.64412113IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MKEGGRKQGS ASPCAACKLL RRRCAADCVF APYFPADEPH KFANVHKVFG ASNVNKMLQE  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQIQLAVAQ AEAVHLRVRQ  120
TQTASCSYWT QPHSPTNSAS PSSKPIFDID MGLDHTSYAD SILLWLNADM IKLNKNRTLE  180
ALVVIEGAAV EIFRPLDYFW FAKRGEAALM VGLWTYFFDY GKRCCNGALY VVLKYCYDLL  240
NIWKMNLLAL LRFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4891127110LOB family transfactor Ramosa2.1
5ly0_B1e-4891127110LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.262YC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015960093.11e-117LOB domain-containing protein 4-like isoform X2
RefseqXP_025694992.11e-117LOB domain-containing protein 4 isoform X2
TrEMBLA0A444ZHX31e-109A0A444ZHX3_ARAHY; Uncharacterized protein
STRINGGLYMA20G02850.11e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-48LOB domain-containing protein 4