PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.210JQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GATA
Protein Properties Length: 304aa    MW: 33282.5 Da    PI: 7.4199
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.210JQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18221254134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  Cs+C++ kTp+WR gp g+ktLCnaCG++y++ +
  Aradu.210JQ 221 CSHCQVQKTPQWRTGPMGPKTLCNACGVRYKSGR 254
                  *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.2E-8028297IPR016679Transcription factor, GATA, plant
SMARTSM004011.6E-14215269IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.28E-14218278No hitNo description
Gene3DG3DSA:3.30.50.106.9E-15219252IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.398219251IPR000679Zinc finger, GATA-type
CDDcd002021.56E-14220277No hitNo description
PfamPF003202.5E-16221254IPR000679Zinc finger, GATA-type
PROSITE patternPS003440221246IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEVVVAKALK PSLRGELIFQ PPLALGDEFL CFNAVNNGAA VGEDFSVDDL LDFSEFQHGS  60
VGKGIDDRTE NDTNSNSSNA AVDSDSIFAG ELSVPDDDLA DLEWVSHFVD DSIPELSLLY  120
PVRSEQTRAR AQPEPKTGSA VTSLPHGVPV KPRTTRTRKP NGRLLWSFGN LFSPPSSPSS  180
CSSSVLSSTA APLVLHGEPP AKKQKRKPEE QTCGLQFQRR CSHCQVQKTP QWRTGPMGPK  240
TLCNACGVRY KSGRLFPEYR PACSPTFSGD IHSNSHRKVL EMRRRKEMSG PEPSPDRAFM  300
LPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015951959.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A151RII01e-124A0A151RII0_CAJCA; GATA transcription factor 12
STRINGGLYMA12G04180.21e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.22e-53GATA transcription factor 3