PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.1RN6D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TCP
Protein Properties Length: 83aa    MW: 9935.54 Da    PI: 10.9379
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.1RN6DgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP891e-27251453
          TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53
                 kkdrh kihT++++RdRRvRls+e+ ++fFdLqd+L f k+s+t+eWL++
  Aradu.1RN6D  2 KKDRHNKIHTSQELRDRRVRLSSEISRKFFDLQDMLEFNKPSNTLEWLFT 51
                 9***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.7E-25251IPR005333Transcription factor, TCP
PROSITE profilePS5136923.92260IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MKKDRHNKIH TSQELRDRRV RLSSEISRKF FDLQDMLEFN KPSNTLEWLF TIEAFKVKWK  60
GGKGKLIFGR FDVKGYVTGV WKS
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.1RN6D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143293.15e-26hypothetical protein PHAVU_007G060100g
RefseqXP_014523924.16e-26transcription factor DICHOTOMA-like
RefseqXP_020232454.27e-26transcription factor DICHOTOMA isoform X1
RefseqXP_027933862.14e-26transcription factor DICHOTOMA-like
RefseqXP_029128870.14e-26transcription factor DICHOTOMA isoform X2
SwissprotQ9SBV94e-19CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment)
TrEMBLA0A0S3SMV71e-24A0A0S3SMV7_PHAAN; Uncharacterized protein
TrEMBLA0A1S3W0Y81e-24A0A1S3W0Y8_VIGRR; transcription factor DICHOTOMA-like
TrEMBLV7BBQ41e-24V7BBQ4_PHAVU; Uncharacterized protein
STRINGXP_007143293.12e-25(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.23e-18TCP family protein
Publications ? help Back to Top
  1. Vieira CP,Vieira J,Charlesworth D
    Evolution of the cycloidea gene family in Antirrhinum and Misopates.
    Mol. Biol. Evol., 1999. 16(11): p. 1474-83
    [PMID:10555278]
  2. Gubitz T,Caldwell A,Hudson A
    Rapid molecular evolution of CYCLOIDEA-like genes in Antirrhinum and its relatives.
    Mol. Biol. Evol., 2003. 20(9): p. 1537-44
    [PMID:12832647]