PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.1M0CF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 494aa    MW: 56159.6 Da    PI: 10.1712
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.1M0CFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.72.3e-211664149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 k+ +n+sn qvtfskRr g++ KA+EL++LC+aeva+i+fs+ +k++ +
  Aradu.1M0CF 16 KKMSNESNLQVTFSKRRGGLFNKASELCTLCGAEVAIIVFSPGQKVFSF 64
                 5689*****************************************9987 PP

2SRF-TF61.88e-20275322249
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                  +i  ks  qvtfskRr g++KKA+EL++LC++e+ +++fs+ +k + +
  Aradu.1M0CF 275 KIPKKSHLQVTFSKRRSGLFKKASELCTLCGVEITIVVFSPADKAFSF 322
                  57789999*********************************9886655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.193868IPR002100Transcription factor, MADS-box
SMARTSM004326.8E-31867IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-27984IPR002100Transcription factor, MADS-box
CDDcd002651.53E-33977No hitNo description
PRINTSPR004044.7E-181030IPR002100Transcription factor, MADS-box
PfamPF003194.4E-231864IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-184566IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.918266326IPR002100Transcription factor, MADS-box
SMARTSM004326.0E-28266325IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-25267349IPR002100Transcription factor, MADS-box
CDDcd002651.16E-29267335No hitNo description
PfamPF003194.2E-22275322IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MSTARKSRGR QKIEMKKMSN ESNLQVTFSK RRGGLFNKAS ELCTLCGAEV AIIVFSPGQK  60
VFSFGHPSVQ TIIDRYLMHA SMHNSGTMQF IEAQRSASVC ELNEQLTRIS NQLDVEKKRS  120
DELSRLQKTV MTQFWWALSI ENMDKTQLNQ LKAALEKLKK SVMYYAEKLH IQGIVANPPQ  180
PLLGLPSSSD VVHHQPPFPP PTTHHVSQLF ASHIRQPLML NGENRLMHNP MFADWSMLHQ  240
HGFNINTGMG GFGNMGGLMS KKKSSLGRQK IPIEKIPKKS HLQVTFSKRR SGLFKKASEL  300
CTLCGVEITI VVFSPADKAF SFGHPEVESI IDRYLVLNPP HESISSTQQL VEAHRNANVR  360
DLNMQLTQLL NHLEMEKKRG EELDHVRKVR QRQFWWESST DDLGFHELIQ LKASIEELKK  420
NLAKHVSKII MMDQTNMDSR IIGVNSNNGL LNRYDHAFDN NKSDAAAFNV APTLPPPNNN  480
AYYMGFRHVW DPKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-15266350185Myocyte-specific enhancer factor 2B
1tqe_Q8e-15266350185Myocyte-specific enhancer factor 2B
1tqe_R8e-15266350185Myocyte-specific enhancer factor 2B
1tqe_S8e-15266350185Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015941650.11e-169PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_015941651.11e-169PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK21e-53AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLK7N3B51e-102K7N3B5_SOYBN; Uncharacterized protein
STRINGGLYMA20G27350.21e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-55AGAMOUS-like 62