PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.18XUI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GATA
Protein Properties Length: 362aa    MW: 39790.7 Da    PI: 6.4213
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.18XUIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18277311135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Aradu.18XUI 277 CSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRL 311
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.978271307IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-14271333No hitNo description
SMARTSM004011.8E-16271325IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14275309IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.47E-15276324No hitNo description
PfamPF003202.0E-16277311IPR000679Zinc finger, GATA-type
PROSITE patternPS003440277302IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MLYQTPHPLL FQFHPFPSSS STLPLSSYHL LIKVEERERE MECMVEGALK TSFRKEMGMG  60
MKYTTSPQRS FMEELQNGAP SDDFFVDQLL DFSQVDQQEE QQEEEQEHKK VGEDSACVSL  120
SPQQTNDVEE TFPSLPTTDL NLPDDVADLE WLSHFVEDSF SQFSPPIVPA AVPTSTPPAP  180
PQPCFNTPVP AKARSKRTRT GVRVWPLASP SFATTDSSST TATATSSTSS SPSSPLLIYA  240
TNLSQTMDQV SSDAPPKKPK KKASPEGGFP AQAPRRCSHC GVQKTPQWRT GPLGAKTLCN  300
ACGVRYKSGR LLPEYRPACS PTFSSELHSN HHRKVLEMRR KKETIGGGVD TSGLAPPVVP  360
SF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964212.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH578e-74GATA5_ARATH; GATA transcription factor 5
TrEMBLC6TAJ41e-105C6TAJ4_SOYBN; Putative uncharacterized protein
TrEMBLI1J8P11e-105I1J8P1_SOYBN; Uncharacterized protein
STRINGGLYMA01G37450.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.12e-56GATA transcription factor 6