PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.0SC6H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 380aa    MW: 42451.8 Da    PI: 7.4183
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.0SC6HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32209264156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W++eLH+rF++a++qLGG++ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Aradu.0SC6H 209 KQRRCWSQELHKRFLQALQQLGGPDSATPKQIRELMKVDGLTNDEVKSHLQKYRLH 264
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.556206266IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-29207267IPR009057Homeodomain-like
SuperFamilySSF466898.24E-19207267IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-28209264IPR006447Myb domain, plants
PfamPF002494.3E-8211262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MQRLKTMMGS RDYIQALEHE RRKIQVFSKE LPLSLDLVTQ AIEACRQQLS ETTTEYNMNG  60
HNSECSEQTT STDNGPVLEE FIPIKKRPSS PHEEEEEEED DDDDEQHSHH HRHKISKDNT  120
DKRKSDWLRS VQLWNNPEPS SPPHQEVNNK KGGAVEVKRS GSGGAFQPFH KEKEERVGGG  180
GGKAIASDDL KPPCSSNSSK KEEKEGQRKQ RRCWSQELHK RFLQALQQLG GPDSATPKQI  240
RELMKVDGLT NDEVKSHLQK YRLHTRRPSG IVHNNGSPQT TPFVLVGNIF VQPPEYAAAA  300
VATSADLAPA GIYAPVATHP PPPPPRTAAG STRRPQLKKS SNHMREDHHH SHSEEDRANH  360
SNSPASSSST HTTTTTSPAY
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.0SC6H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015942761.10.0transcription factor HRS1
SwissprotQ9FPE82e-83HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A445BCI60.0A0A445BCI6_ARAHY; Uncharacterized protein
STRINGXP_007143802.11e-139(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-72G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]