PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.0BT33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 147aa    MW: 17182.7 Da    PI: 9.6591
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.0BT33genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.4e-311870254
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                 prlrWtpeLHe+Fveave+LGG++kAtPk+il+ m vkgL ++h+kSHLQ+YR
  Aradu.0BT33 18 PRLRWTPELHEQFVEAVESLGGKHKATPKQILQQMPVKGLRIAHIKSHLQMYR 70
                 8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1831474IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-281571IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-231871IPR006447Myb domain, plants
SuperFamilySSF466891.2E-141871IPR009057Homeodomain-like
PfamPF002491.1E-101970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MRTWEKIGVR QYNKSELPRL RWTPELHEQF VEAVESLGGK HKATPKQILQ QMPVKGLRIA  60
HIKSHLQMYR NLKGHASLSV DHLMEEYQHV KDLKITSIPS PKRSSIVTNL TDSNYERRIL  120
REDLHLSNGI SQISEETDYD LNQVLFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-201973357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-201973357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-201973357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-201973357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-201973458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.0BT33
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015973186.11e-105myb-related protein 2-like
TrEMBLA0A445C3V31e-101A0A445C3V3_ARAHY; Uncharacterized protein
STRINGGLYMA02G45231.14e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.16e-27G2-like family protein