PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.08TAH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 229aa    MW: 26662 Da    PI: 5.7905
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.08TAHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM121.38.6e-38521711128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF Ptdeelvv++L++k++  +++  +vi+++d+y ++Pw+L+ ++ ae ++wy++s+r +        +r+t++gyWkatg +++v+++ ++
  Aradu.08TAH  52 LPPGFRFYPTDEELVVHFLHRKAALLPCHP-DVIPDLDLYPYDPWELDGRALAEGNQWYYYSRRTQ--------SRVTENGYWKATGMEEPVMTSsTN 140
                  79*************************999.99**************977778899******9854........799****************98677 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vg+kk +vf+ g++p++ kt+W+m+ey l
  Aradu.08TAH 141 KRVGIKKYFVFHLGESPSAIKTNWIMQEYCL 171
                  88***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-4847198IPR003441NAC domain
PROSITE profilePS5100546.49552199IPR003441NAC domain
PfamPF023653.1E-2253171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
AWVSRQHPYY KYLSFSICTI NTTHLHHYSN LTHSLLLFSL LIFLMGDNNV NLPPGFRFYP  60
TDEELVVHFL HRKAALLPCH PDVIPDLDLY PYDPWELDGR ALAEGNQWYY YSRRTQSRVT  120
ENGYWKATGM EEPVMTSSTN KRVGIKKYFV FHLGESPSAI KTNWIMQEYC LSDYSASSSR  180
SSKRKSDYSK WVICRVYERN GDDDDGTELS CLDEVFLSLD DLDEISLPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-404820013166NO APICAL MERISTEM PROTEIN
1ut4_B4e-404820013166NO APICAL MERISTEM PROTEIN
1ut7_A4e-404820013166NO APICAL MERISTEM PROTEIN
1ut7_B4e-404820013166NO APICAL MERISTEM PROTEIN
3swm_A5e-404820016169NAC domain-containing protein 19
3swm_B5e-404820016169NAC domain-containing protein 19
3swm_C5e-404820016169NAC domain-containing protein 19
3swm_D5e-404820016169NAC domain-containing protein 19
3swp_A5e-404820016169NAC domain-containing protein 19
3swp_B5e-404820016169NAC domain-containing protein 19
3swp_C5e-404820016169NAC domain-containing protein 19
3swp_D5e-404820016169NAC domain-containing protein 19
4dul_A4e-404820013166NAC domain-containing protein 19
4dul_B4e-404820013166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.08TAH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015943391.11e-137NAC domain-containing protein 104
RefseqXP_025622374.11e-137NAC domain-containing protein 104
SwissprotQ8GWK66e-90NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A445BAD71e-136A0A445BAD7_ARAHY; Uncharacterized protein
STRINGGLYMA08G19300.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.13e-86xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]