PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.05MVI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 287aa    MW: 33734 Da    PI: 8.4575
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.05MVIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.52.4e-2536118186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k+lWe +s+ m+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Aradu.05MVI  36 QWSIQETKEFLMIRAELDQTFMETKRNKQLWEVISNTMKEKGYHRSAEQCKCKWKNLVTRYKGCETMEAEA---MRQQFPFYNELQ 118
                  7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.18E-2235100No hitNo description
PfamPF138374.6E-2136120No hitNo description
PROSITE profilePS500907.2593793IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
YPPPQRHNIS AATTTSAGTN NNVVVVDVTG DSRFPQWSIQ ETKEFLMIRA ELDQTFMETK  60
RNKQLWEVIS NTMKEKGYHR SAEQCKCKWK NLVTRYKGCE TMEAEAMRQQ FPFYNELQAI  120
FTDRMQRMLW AETEGGGGGG GSSNNKKKAA TAQLSSDDEE EEESELGDPQ QKNVKRKKRL  180
KKVKRVEDSG GASNLKHLKG ILEEFMRQQM EMEAQWMSVF EARENDRRLK ELEWRQTMEA  240
LENQRMMMEQ RWRESEEQWR IREEARAHKR DALITALLNK LSRQQDQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174180KRKKRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-57AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015960961.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804505e-69TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0S3RUB81e-118A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGGLYMA03G07590.21e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-61Trihelix family protein