PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.039HC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 522aa    MW: 58406.9 Da    PI: 6.6345
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.039HCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.26.8e-3971061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++C++apyfp ++p++fa vh++FGasn+ k+l++l++ +reda++sl++eAear++ PvyG+v++i  lqq+l+q + +l ++k
  Aradu.039HC   7 PCAACKFLRRKCTQECIFAPYFPPDNPQRFASVHRVFGASNIGKILNDLSPCQREDAVTSLAFEAEARLDSPVYGCVRHIVILQQRLHQIQMDLLHAK 104
                  7*******************************************************************************************998888 PP

       DUF260  99 ee 100
                  +e
  Aradu.039HC 105 SE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.4926107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-387103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MSSTNSPCAA CKFLRRKCTQ ECIFAPYFPP DNPQRFASVH RVFGASNIGK ILNDLSPCQR  60
EDAVTSLAFE AEARLDSPVY GCVRHIVILQ QRLHQIQMDL LHAKSELSAY INPQGIQGPF  120
SPHGIRGLPL YPQGKPPSSS AALFGPPYGP NVIQSLMPPS SVQHNGTMNA NADLDPEQRE  180
LLGAAQQHDM MVRNYEQQQQ QQQQEYLRYN AATGVIEPVA AASPVSVVTA DGDGRGNGVF  240
AQMAAHSGGQ GGELTPCLGL GTFDSGGTYH HQLQQEPPQH GGVGENYVGL ANRHHYPVEA  300
QFLLPSQQQQ SESEDFVAFA YNNKQAREQE VVEEAGGYWK VATDVEMYYN NHFLMQHDLL  360
RELANHQSNQ ESIERRKRLV IDLTQNGKNC PNWLVGQNQP GIVSRMLSFL SVRGTQQQQK  420
QEQVTARIMF VSTDETFTPD WYNMNHDETE VLILNIHSNK YTFPDFIQKM RKLKVLIVTN  480
QGFHPCELNN FEVLGSLPCL KTIRLEKVSI PSLCKFNKLS LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-42611010114LOB family transfactor Ramosa2.1
5ly0_B6e-42611010114LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.039HC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020981134.10.0protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A445EXF90.0A0A445EXF9_ARAHY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2333723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-55ASYMMETRIC LEAVES 2-like 1